Dbfetch

ID   U59691; SV 1; linear; genomic DNA; STD; HUM; 246 BP.
XX
AC   U59691;
XX
DT   01-OCT-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MHC class II antigen HLA-DRB1 (HLA-DRB1*13) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-246
RX   DOI; 10.1111/j.1399-0039.1997.tb02736.x.
RX   PUBMED; 9062978.
RA   Schaffer M., Olerup O.;
RT   "A novel DRB1*13 allele (DRB1*1327) on a DR17, DQ2 haplotype with a
RT   DRB1*0301 sequence motif in the 2nd hyperpolymorphic region";
RL   Tissue Antigens 49(2):186-188(1997).
XX
RN   [2]
RP   1-246
RA   Schaffer M., Olerup O.;
RT   ;
RL   Submitted (30-MAY-1996) to the INSDC.
RL   Department of Biosciences, CBT, Halsovagen 7-9, Huddinge S-141 57, Sweden
XX
DR   MD5; e87d575f9fd0da00ef4319750309e41e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..246
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /strain="Caucasian"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>246
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen HLA-DRB1"
FT                   /db_xref="GOA:O19791"
FT                   /db_xref="IMGT/HLA:DRB1*13:27"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19791"
FT                   /protein_id="AAB71492.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVV"
FT   exon            <1..>246
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 246 BP; 53 A; 59 C; 88 G; 46 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtgg                                                                  246
//