Dbfetch

ID   U59442; SV 1; linear; genomic DNA; STD; HUM; 255 BP.
XX
AC   U59442;
XX
DT   06-JAN-1999 (Rel. 58, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II antigen DPbeta1 gene (DPB1*5901 allele), partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-255
RX   DOI; 10.1111/j.1399-0039.1997.tb02788.x.
RX   PUBMED; 9174146.
RA   Noreen H., Steiner L., Davidson M., Johnson S., Segall M., Begovich A.B.;
RT   "Six new DPB1 alleles identified in a study of 1,302 unrelated bone marrow
RT   donor-recipient pairs";
RL   Tissue Antigens 49(5):512-516(1997).
XX
RN   [2]
RP   1-255
RA   Steiner L., Begovich A., Noreen H.;
RT   ;
RL   Submitted (29-MAY-1996) to the INSDC.
RL   Human Genetics, Roche Molecular Systems, 1145 Atlantic Avenue, Alameda, CA
RL   94501, USA
XX
DR   MD5; 1632493a40a4bad46c635dc0aaf1ae46.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..255
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>255
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen DPbeta1"
FT                   /note="Allele: DPB1*5901"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*59:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAD09486.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDLLEEKRAVPDRMCRHNYELGGPMTLQ"
XX
SQ   Sequence 255 BP; 59 A; 62 C; 93 G; 41 T; 0 other;
     aattaccttt tccagggacg gcaggaatgc tacgcgttta atgggacaca gcgcttcctg        60
     gagagataca tctacaaccg ggaggagttc gtgcgcttcg acagcgacgt gggggagttc       120
     cgggcggtga cggagctggg gcggcctgat gaggagtact ggaacagcca gaaggacctc       180
     ctggaggaga agcgggcagt gccggacagg atgtgcagac acaactacga gctgggcggg       240
     cccatgaccc tgcag                                                        255
//