spacer

EBI Dbfetch

ID   AH005674; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH005674; U58643-U58644;
XX
DT   29-JUL-2011 (Rel. 109, Created)
DT   29-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I HLA-B40MD alpha chain gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Gao X., Matheson B.;
RT   "A Novel B60 variant found in Oceanic populations";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Gao X.;
RT   ;
RL   Submitted (20-MAY-1996) to the INSDC.
RL   Xiaojiang Gao, The Australian National University, Human Genetics Group,
RL   Acton, Canberra, Act, 2601, Australia
XX
CC   On or before Jul 28, 2011 this sequence version replaced
CC   gi:2654418, gi:2654419, gi:2654420.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="MD676"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /product="MHC class I HLA-B40MD alpha chain"
FT                   /db_xref="GOA:O78029"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O78029"
FT                   /protein_id="AAB87726.1"
FT                   /translation="CSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDATSPRK
FT                   EPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /number=2
FT                   /note="HLA-B*40MD; alpha chain first domain"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /number=3
FT                   /note="HLA-B*40MD; alpha chain second domain"
XX
SQ   Sequence 646 BP; 116 A; 168 C; 189 G; 73 T; 100 other;
     aatgctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc        60
     cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgaggttc gacagcgacg       120
     ccacgagtcc gaggaaggag ccgcgggcgc catggataga gcaggagggg ccggagtatt       180
     gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag agcctgcgga       240
     acctgcgcgg ctactacaac cagagcgagg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatctccca gcgcaagttg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac aagctggagc gcgctg                      646
//


spacer
spacer