Dbfetch

ID   AH003592; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH003592; U58469-U58470;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen SHCHA (HLA-B) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1034/j.1399-0039.2001.057004376.x.
RX   PUBMED; 11380952.
RA   Steiner N.K., Gans C.P., Kosman C., Bradshaw D., Koester R., Menchaca E.M.,
RA   Mitton W., Ng J., Hartzman R.J., Hurley C.K.;
RT   "New alleles in the B44 family including B*44022, B*44032, B*4411, B*4420,
RT   B*4421, B*4424, and B*8301";
RL   Tissue Antigens 57(4):376-379(2001).
XX
RN   [2]
RP   1-646
RA   Hurley C.K., Steiner N.K.;
RT   "Novel HLA-B alleles";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Hurley C.K., Steiner N.K.;
RT   ;
RL   Submitted (16-MAY-1996) to the INSDC.
RL   C.K. Hurley, Microbiology & Immunology, Georgetown University, 3970
RL   Reservoir Rd.NW, Washington, DC 20007, USA
XX
DR   MD5; 37926e19b3f15866bf58d3bdda0f0353.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:1378136, gi:1378137, gi:1378138.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="B*5101/B*4403 variant"
FT                   /cell_type="PBL"
FT                   /note="SHCHA-B*4403 variant, Direct sequence"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen SHCHA"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen SHCHA"
FT                   /note="HLA-B*4403 variant"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:O19669"
FT                   /protein_id="AAB02607.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VESLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="HLA-B*4403 variant"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="HLA-B*4403 variant"
XX
SQ   Sequence 646 BP; 113 A; 172 C; 188 G; 73 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtatga ccaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtcg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//