spacer

EBI Dbfetch

ID   U58026; SV 1; linear; mRNA; STD; HUM; 821 BP.
XX
AC   U58026;
XX
DT   24-MAY-1997 (Rel. 52, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human lymphocyte antigen G (HLA-G) mRNA, partial cds, clone CEPH-G4.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-821
RX   DOI; 10.1016/S0198-8859(97)00038-4.
RX   PUBMED; 9129971.
RA   Kirszenbaum M., Djoulah S., Hors J., Le Gall I., de Oliveira E.B.,
RA   Prost S., Dausset J., Carosella E.D.;
RT   "HLA-G gene polymorphism segregation within CEPH reference families";
RL   Hum. Immunol. 53(2):140-147(1997).
XX
RN   [2]
RP   1-821
RA   Kirszenbaum M., Djoulah S., de Oliveira E.B., Prost S., Legal I.,
RA   Dausset J., Hors J., Carosella E.D.;
RT   ;
RL   Submitted (10-MAY-1996) to the INSDC.
RL   CEA-DSV-DRM-SRHI, Laboratoire d'Immunoradiobiologie, Hospital St-Louis,
RL   Centre Hayem, 1, Commissariat A L Energie Atomique DSV/DRM,
RL   CEA-DSV-DRM-SRHI, Av Claude Vellefaux, Paris 75010, France
XX
RN   [3]
RC   Sequence update by submitter
RP   1-821
RA   Kirszenbaum M., Djoulah S., de Oliveira E.B., Prost S., Legal I.,
RA   Dausset J., Hors J., Carosella E.D.;
RT   ;
RL   Submitted (26-FEB-1998) to the INSDC.
RL   CEA-DSV-DRM-SRHI, Laboratoire d'Immunoradiobiologie, Hospital St-Louis,
RL   Centre Hayem, 1, Commissariat A L Energie Atomique DSV/DRM,
RL   CEA-DSV-DRM-SRHI, Av Claude Vellefaux, Paris 75010, France
XX
DR   MD5; 10b3b65163380b0bbb49b9bcd701abe6.
DR   H-InvDB; HIT000220511_03.4.
DR   H-InvDB; HIT000220511_04.4.
DR   H-InvDB; HIT000220511_05.4.
XX
CC   On Feb 26, 1998 this sequence version replaced gi:2105105.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..821
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="CEPH family nr 27"
FT                   /mol_type="mRNA"
FT                   /clone="CEPH-G4"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>821
FT                   /codon_start=3
FT                   /gene="HLA-G"
FT                   /db_xref="GOA:O02925"
FT                   /db_xref="H-InvDB:HIT000220511_02.4"
FT                   /db_xref="IMGT/HLA:G*01:04:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O02925"
FT                   /protein_id="AAC04371.1"
FT                   /translation="SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME
FT                   PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS
FT                   DGRLIRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTC
FT                   VEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGED
FT                   QTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRW"
FT   variation       170
FT                   /gene="HLA-G"
FT                   /note="polymorphism"
FT   variation       278
FT                   /gene="HLA-G"
FT                   /note="polymorphism"
FT   variation       320
FT                   /gene="HLA-G"
FT                   /note="polymorphism"
FT   variation       327
FT                   /gene="HLA-G"
FT                   /note="polymorphism"
FT   variation       563
FT                   /gene="HLA-G"
FT                   /note="polymorphism"
XX
SQ   Sequence 821 BP; 171 A; 242 C; 282 G; 126 T; 0 other;
     gctcccactc catgaggtat ttcagcgccg ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc catgggctac gtggacgaca cgcagttcgt gcggttcgac agcgactcgg       120
     cgtgtccgag gatggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     aagaggagac acggaacacc aaggcccacg cacagactga cagaatgaac ctgcagaccc       240
     tgcgcggcta ctacaaccag agcgaggcca gttctcacac cctccagtgg atgattggct       300
     gcgacctggg gtccgacgga cgcctcatcc gcgggtatga acagtatgcc tacgatggca       360
     aggattacct cgccctgaac gaggacctgc gctcctggac cgcagcggac actgcggctc       420
     agatctccaa gcgcaagtgt gaggcggcca atgtggctga acaaaggaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccacagat acctggagaa cgggaaggag atgctgcagc       540
     gcgcggaccc ccccaagaca cacgtgaccc accaccctgt ctttgactat gaggccaccc       600
     tgaggtgctg ggccctgggc ttctaccctg cggagatcat actgacctgg cagcgggatg       660
     gggaggacca gacccaggac gtggagctcg tggagaccag gcctgcaggg gatggaacct       720
     tccagaagtg ggcagctgtg gtggtgcctt ctggagagga gcagagatac acgtgccatg       780
     tgcagcatga ggggctgccg gagcccctca tgctgagatg g                           821
//


spacer
spacer