spacer

EBI Dbfetch

ID   AH003581; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH003581; U56434-U56435;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen R69772 (HLA-A) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Hurley C.K., Steiner N.K.;
RT   "Novel HLA-A alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Hurley C.K., Steiner N.K.;
RT   ;
RL   Submitted (24-APR-1996) to the INSDC.
RL   C.K. Hurley, Microbiology & Immunology, Georgetown University, 3970
RL   Reservoir Rd.NW, Washington, DC 20007, USA
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:1336036, gi:1336037, gi:1336038.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A*0205/A*0302"
FT                   /cell_type="PBL"
FT                   /db_xref="taxon:9606"
FT   gene            1..646
FT                   /gene="HLA-A"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen R69772"
FT                   /note="A*0302"
FT                   /db_xref="GOA:Q29634"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29634"
FT                   /protein_id="AAB01213.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLDGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="A*0302"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="A*0302"
XX
SQ   Sequence 646 BP; 109 A; 162 C; 197 G; 78 T; 100 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgtggcgga gcagcagaga gcctacctgg atggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer