spacer

EBI Dbfetch

ID   AH005606; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH005606; U52169-U52170;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen HLA-B (HLA-B) gene, HLA-B-B*51012 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1016/S0198-8859(97)00112-2.
RX   PUBMED; 9455497.
RA   Steiner N., Ng J., Bush J., Hartzman R.J., Johnston-Dow L., Hurley C.K.;
RT   "HLA-B alleles associated with the B15 serologically defined antigens";
RL   Hum. Immunol. 56(1-2):84-93(1997).
XX
RN   [2]
RP   1-646
RA   Hurley C.K., Steiner N.K.;
RT   ;
RL   Submitted (25-MAR-1996) to the INSDC.
RL   Microbiology & Immunology, Georgetown University Medical Center, 3970
RL   Reservoir Rd. NW, Washington, DC 20007, USA
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:1272454, gi:1272455, gi:1272456.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="B*1535/B*51012"
FT                   /cell_type="PBL"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="B*51012"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="B*51012"
FT                   /product="MHC class I antigen HLA-B"
FT                   /note="GN00106-B*51012"
FT                   /db_xref="GOA:O19747"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19747"
FT                   /protein_id="AAB82331.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="B*51012"
FT                   /number=2
FT                   /note="GN00106-B*51012"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="B*51012"
FT                   /number=3
FT                   /note="GN00106-B*51012"
XX
SQ   Sequence 646 BP; 115 A; 173 C; 186 G; 72 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagacg atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aagattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagac acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer