Dbfetch

ID   U50710; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   U50710;
XX
DT   05-APR-1996 (Rel. 47, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class I heavy chain HLA-B allele (HLA-B) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RA   Bettinotti M.P.;
RT   ;
RL   Submitted (05-MAR-1996) to the INSDC.
RL   M.P. Bettinotti, Tissue Typing Lab., UCLA, 950 Veteran Ave., Los Angeles,
RL   CA 90095, USA
XX
DR   MD5; 061746180a2a5b28adfc620f85ea5880.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /cell_type="peripheral blood mononuclear cells"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I HLA-B heavy chain"
FT                   /note="this allele is identical to allele HLA-B1525 whose
FT                   sequence was reported only as far as exon 2 and 3"
FT                   /db_xref="GOA:Q29748"
FT                   /db_xref="H-InvDB:HIT000220181.14"
FT                   /db_xref="IMGT/HLA:B*15:25:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q29748"
FT                   /protein_id="AAA93482.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 1089 BP; 222 A; 335 C; 359 G; 173 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggatggcg ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggta tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//