Dbfetch

ID   AH005601; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH005601; U49904-U49905;
XX
DT   08-APR-2016 (Rel. 128, Created)
DT   08-APR-2016 (Rel. 128, Last updated, Version 1)
XX
DE   Homo sapiens haplotype B*1534/B*0702 MHC class I antigen GN00105 (HLA-B)
DE   gene, HLA-B-B*0702 allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1016/S0198-8859(97)00112-2.
RX   PUBMED; 9455497.
RA   Steiner N., Ng J., Bush J., Hartzman R.J., Johnston-Dow L., Hurley C.K.;
RT   "HLA-B alleles associated with the B15 serologically defined antigens";
RL   Hum. Immunol. 56(1-2):84-93(1997).
XX
RN   [2]
RP   1-646
RA   Hurley C.K., Steiner N.K.;
RT   ;
RL   Submitted (26-FEB-1996) to the INSDC.
RL   K.C. Hurley, Microbiology & Immunology, Georgetown University, 3970
RL   Reservoir Rd.NW, Washington, DC 20007, USA
XX
DR   MD5; f0031c819fb54a790ad4c25e97a5d697.
XX
CC   On or before Apr 6, 2016 this sequence version replaced gi:1236147,
CC   gi:1236148, gi:1236149.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="B*1534/B*0702"
FT                   /note="PBL, GN00105-B*0702, Direct sequence"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="B*0702"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="B*0702"
FT                   /product="MHC class I antigen GN00105"
FT                   /protein_id="AAB82056.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="B*0702"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="B*0702"
FT                   /number=3
XX
SQ   Sequence 646 BP; 111 A; 172 C; 194 G; 69 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac aagctggagc gcgctg                      646
//