spacer

EBI Dbfetch

ID   U49901; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   U49901;
XX
DT   05-APR-1996 (Rel. 47, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens MHC class I antigen GN00104-B*1530 (HLA-B) gene,
DE   B*1534/B*0702, exon 3, and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1016/S0198-8859(97)00112-2.
RX   PUBMED; 9455497.
RA   Steiner N., Ng J., Bush J., Hartzman R.J., Johnston-Dow L., Hurley C.K.;
RT   "HLA-B alleles associated with the B15 serologically defined antigens";
RL   Hum. Immunol. 56(1-2):84-93(1997).
XX
RN   [2]
RP   1-276
RA   Hurley C.K., Steiner N.K.;
RT   ;
RL   Submitted (26-FEB-1996) to the INSDC.
RL   K.C. Hurley, Microbiology & Immunology, Georgetown University, 3970
RL   Reservoir Rd.NW, Washington, DC 20007, USA
XX
DR   MD5; c5a61efda3e31c23c53092a919062fc9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="B*1530/B*39062"
FT                   /note="PBL, GN00104-B*1530, Direct sequence"
FT                   /db_xref="taxon:9606"
FT   CDS             join(U49900.1:<1..270,1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen GN00104"
FT                   /db_xref="GOA:Q30184"
FT                   /db_xref="IMGT/HLA:B*15:30"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q30184"
FT                   /protein_id="AAB82055.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 276 BP; 54 A; 84 C; 104 G; 34 T; 0 other;
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagtggaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer