spacer

EBI Dbfetch

ID   U45999; SV 1; linear; genomic DNA; STD; HUM; 220 BP.
XX
AC   U45999;
XX
DT   14-FEB-1996 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human class II HLADR-beta 1 chain (HLA-DRB1) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-220
RA   Sese D.E., Amac N., Beato F., Castro M., Milford E.L.;
RT   ;
RL   Submitted (16-JAN-1996) to the INSDC.
RL   Doreen E. Sese, Tissue Typing Laboratory, Brigham and Women's Hospital, 75
RL   Francis Street, Boston, MA 02115, USA
XX
DR   MD5; 9f97ca13d1fa39a7a6f00c1ca4527001.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..220
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..220
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   gene            1..220
FT                   /gene="HLA-DRB1"
FT   CDS             <1..>220
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="class II HLADR-beta 1 chain"
FT                   /note="class II HLA histocompatibility antigen"
FT                   /db_xref="GOA:Q29744"
FT                   /db_xref="IMGT/HLA:DRB1*15:06:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29744"
FT                   /protein_id="AAA87226.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAATELGRPDA
FT                   EYWNSQKDILEQARAAVDTYCRHNYGVV"
XX
SQ   Sequence 220 BP; 44 A; 54 C; 84 G; 38 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttctataac        60
     caggaggagt ccgtgcgctt cgacagcgac gtgggggagt tccgggcggc gacggagctg       120
     gggcggcctg acgctgagta ctggaacagc cagaaggaca tcctggagca ggcgcgggcc       180
     gcggtggaca cctactgcag acacaactac ggggttgtgg                             220
//


spacer
spacer