Dbfetch

ID   U44064; SV 1; linear; genomic DNA; STD; HUM; 1139 BP.
XX
AC   U44064;
XX
DT   11-FEB-1996 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human histocompatibility class I antigen HLA-Cw3 (HLA-C) gene, allele
DE   Cw*0304, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1139
RX   PUBMED; 6609813.
RA   Sodoyer R., Damotte M., Delovitch T.L., Trucy J., Jordan B.R., Strachan T.;
RT   "Complete nucleotide sequence of a gene encoding a functional human class I
RT   histocompatibility antigen (HLA-CW3)";
RL   EMBO J. 3(4):879-885(1984).
XX
RN   [2]
RP   1-1139
RX   DOI; 10.1007/s002510050093.
RX   PUBMED; 8613148.
RA   Zarling A.L., Smith K.D., Lutz C.T., Lee D.R.;
RT   "Correction of the HLA-Cw3 genomic sequence tentatively identifies it as
RT   HLA-Cw*0304";
RL   Immunogenetics 44(1):82-83(1996).
XX
RN   [3]
RP   1-1139
RA   Zarling A.L., Smith K.D., Lutz C.T., Lee D.R.;
RT   ;
RL   Submitted (29-DEC-1995) to the INSDC.
RL   David R. Lee, Mol. Micro. & Immunol., University of Missouri, M642 Medical
RL   Science Building, Columbia, MO 65212, USA
XX
DR   MD5; ed931fc3b184d53963395b1e94e60ef1.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
CC   This is a corrected sequence from the 5' portion of the previously
CC   designated HLA-Cw3 (later redesignated HLA-Cw*0301) genomic clone
CC   (GenBank Accession Number X00495). This sequence information
CC   indicates that this clone matches the HLA-C*0304 cDNA sequence in
CC   the first three exons.  Definitive assignment of this clone as
CC   Cw*0304 awaits further comparison of the exons of the 3' portion
CC   with the Cw*0304 cDNA sequence. However, since almost all of the
CC   differences among alleles at this locus occur in exons 2 and 3, we
CC   have tenatively assigned the previously designated Cw*0301 genomic
CC   clone as Cw*0304. McCutcheon, J.A. J. Exp. Med. 181:2085-2095, 1995
CC   and Arnett, K.L. Tissue Antigens 45:217-257, 1995.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1139
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /note="Sequence was derived from Cw3pHEBo obtained from
FT                   C.T. Lutz (Univ. of Iowa, Iowa City, IA) who derived the
FT                   plasmid from the p42 plasmid obtained from H. Ploegh (MIT,
FT                   Cambridge, MA)"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,205..474,717..>992)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /product="HLA-Cw3"
FT                   /note="function: antigen presentation;  Allele: w3
FT                   (tenatively redesignated Cw*0304);  Human
FT                   histocompatibility class I antigen"
FT                   /db_xref="GOA:P04222"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*03:04:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1EFX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04222"
FT                   /protein_id="AAB02773.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRA"
XX
SQ   Sequence 1139 BP; 199 A; 356 C; 418 G; 166 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggtgagtg cggggttggg agggaatcgg cctcttgcgg agaggagcga       120
     ggggcccgcc cggcggaggg cgcaggaccc ggggagccgc gcagggagga gggtcgggcg       180
     ggtctcagcc cctcctcgcc ccaggctccc actccatgag gtatttctac accgctgtgt       240
     cccggcccgg ccgcggggag ccccacttca tcgcagtggg ctacgtggac gacacgcagt       300
     tcgtgcggtt cgacagcgac gccgcgagtc cgagagggga gccgcgggcg ccgtgggtgg       360
     agcaggaggg gccggagtat tgggaccggg agacacagaa gtacaagcgc caggcacaga       420
     ctgaccgagt gagcctgcgg aacctgcgcg gctactacaa ccagagcgag gccggtgagt       480
     ggaccccggc ccggggcgca ggtcacgacc cctcctcatc ccccacggac ggcccgggtc       540
     gccccaagtc tcccggtctg agatccaccc cgaggctgcg gaacccgaga ccctcgaccg       600
     gagagagccc cagtcacctt tacccggttt cattttcagt ttaggccaaa atccccgcgg       660
     gttggtcggg gcggggcggg gctcggggga cggggctgac cgcgggggcg ggccagggtc       720
     tcacatcatc cagaggatgt atggctgcga cgtggggccc gacgggcgcc tcctccgcgg       780
     gtatgaccag tacgcctacg acggcaagga ttacatcgcc ctgaacgagg atctgcgctc       840
     ctggaccgcc gcggacacgg cggctcagat cacccagcgc aagtgggagg cggcccgtga       900
     ggcggagcag ctgagagcct acctggaggg cctgtgcgtg gagtggctcc gcagatacct       960
     gaagaatggg aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg agccttcccc      1020
     atctcctgta gatctcccgg gatggcctcc cacgaggagg ggaggaaaat gggatcagcg      1080
     ctagaatatc gccctccctt gaatggagaa tgggatgagt tttcctgagt ttcctctga       1139
//