spacer

EBI Dbfetch

ID   U43337; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   U43337;
XX
DT   14-FEB-1996 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class I antigen HLA-B mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Chopek M., Nielsen J., Zhang H.;
RT   ;
RL   Submitted (15-DEC-1995) to the INSDC.
RL   Joe Nielsen, HLA, American Red Cross, 15601 Crabbs Branch Way, Rockville,
RL   MD 20855, USA
XX
DR   MD5; fedf7f54d26f2a29fc17379c57bc0ecc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /note="cell No. 64B"
FT                   /db_xref="taxon:9606"
FT   CDS             <3..>546
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B"
FT                   /function="peptide presention"
FT                   /note="histocompatibility molecule"
FT                   /db_xref="GOA:Q29718"
FT                   /db_xref="H-InvDB:HIT000219848.9"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*82:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29718"
FT                   /protein_id="AAA87573.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQRMFGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEDLC
FT                   VESLRRYLENGKETLQRA"
XX
SQ   Sequence 546 BP; 112 A; 171 C; 190 G; 73 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtttggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggcataa ccagttagcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcaggacaga gcctacctgg       480
     aggacctgtg cgtggagtcg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer