spacer

EBI Dbfetch

ID   U41490; SV 1; linear; genomic DNA; STD; HUM; 235 BP.
XX
AC   U41490;
XX
DT   26-DEC-1995 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class II histocompatibility antigen beta chain, isolate HL.BWH,
DE   HLA-DRB1  (DRB1-14variant allele) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-235
RA   Hurley Carolyn.;
RT   ;
RL   Submitted (29-NOV-1995) to the INSDC.
RL   Carolyn K. Hurley, Microbiology, Georgetown University School of Medicine,
RL   3970 Reservior Rd. NW, Wshington, DC 20007, USA
XX
DR   MD5; 0de95e0d696ac4e980348886a519e69a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..235
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="HL.BWH"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1-14v, 08032; DRB3-0202; DQB1-05/06,
FT                   0301/0303"
FT                   /cell_type="B lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>235
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II HLA beta chain"
FT                   /note="DRB1-14variant allele"
FT                   /db_xref="GOA:Q29735"
FT                   /db_xref="IMGT/HLA:DRB1*14:25"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29735"
FT                   /protein_id="AAA86243.1"
FT                   /translation="EYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTEL
FT                   GRPAAEHWNSQKDFLEDRRAAVDTYCRHNYGVG"
XX
SQ   Sequence 235 BP; 50 A; 56 C; 86 G; 43 T; 0 other;
     gagtactcta cgtctgagtg tcatttcttc aatgggacgg agcgggtgcg gttcctggac        60
     agatacttct ataaccaaga ggagtacgtg cgcttcgaca gcgacgtggg ggagtaccgg       120
     gcggtgacgg agctggggcg gcctgctgcg gagcactgga acagccagaa ggacttcctg       180
     gaagacaggc gggccgcggt ggacacctac tgcagacaca actacggggt tggtg            235
//


spacer
spacer