spacer

EBI Dbfetch

ID   U39090; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   U39090;
XX
DT   21-JUN-1996 (Rel. 48, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human MHC class II DQ beta chain (HLA-DQB1) gene, exon 2, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RA   Olerup O.H.;
RT   "A novel DQB1*02 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-269
RA   Olerup O.H.;
RT   ;
RL   Submitted (23-OCT-1995) to the INSDC.
RL   Olle H Olerup, Center for BioTechnology, Karolinska Institute, Halsovagen
RL   7-9, Huddinge, S-141 57, Sweden
XX
DR   MD5; 1deb9fdc490b8c0d4c21acc8771748a4.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /isolate="DL-13"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            <1..>269
FT                   /gene="HLA-DQB1"
FT                   /number=2
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II DQ beta chain"
FT                   /note="DQB1*02 allele"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*02:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAB02681.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAV
FT                   TLLGLPDAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRR"
XX
SQ   Sequence 269 BP; 62 A; 66 C; 95 G; 46 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggaca gagcgcgtgc        60
     gtcttgtgag cagaagcatc tataaccgag aagagatcgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg ctgctggggc tgcctgacgc cgagtactgg aacagccaga       180
     aggacatcct ggagaggaaa cgggcggcgg tggacagggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcga                                         269
//


spacer
spacer