Dbfetch

ID   AH003596; SV 2; linear; genomic DNA; STD; HUM; 571 BP.
XX
AC   AH003596; U39089-U39090;
XX
DT   08-APR-2016 (Rel. 128, Created)
DT   08-APR-2016 (Rel. 128, Last updated, Version 1)
XX
DE   Homo sapiens isolate DL-13 MHC class II DQ beta chain (HLA-DQB1) gene,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-571
RA   Olerup O.H.;
RT   "A novel DQB1*02 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-571
RA   Olerup O.H.;
RT   ;
RL   Submitted (23-OCT-1995) to the INSDC.
RL   Olle H Olerup, Center for BioTechnology, Karolinska Institute, Halsovagen
RL   7-9, Huddinge, S-141 57, Sweden
XX
DR   MD5; 549adf2ca249899aa10b260614850df0.
XX
CC   On or before Apr 6, 2016 this sequence version replaced gi:1381389,
CC   gi:1381390, gi:1381391.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..571
FT                   /organism="Homo sapiens"
FT                   /isolate="DL-13"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..571
FT                   /gene="HLA-DQB1"
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II DQ beta chain"
FT                   /note="DQB1*02 allele"
FT                   /protein_id="AAB02681.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAV
FT                   TLLGLPDAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRR"
FT   exon            <1..>269
FT                   /gene="HLA-DQB1"
FT                   /number=2
FT   gap             270..369
FT                   /estimated_length=unknown
FT   CDS             <370..>571
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II DQ beta chain"
FT                   /note="DQB1*02 allele"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /protein_id="AAB02682.1"
FT                   /translation="PSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNGQEETAGVVSTPL
FT                   IRNGDWTFQILVMLEMTPQRG"
FT   exon            <370..>571
FT                   /gene="HLA-DQB1"
FT                   /number=3
XX
SQ   Sequence 571 BP; 107 A; 126 C; 150 G; 88 T; 100 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggaca gagcgcgtgc        60
     gtcttgtgag cagaagcatc tataaccgag aagagatcgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg ctgctggggc tgcctgacgc cgagtactgg aacagccaga       180
     aggacatcct ggagaggaaa cgggcggcgg tggacagggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgan nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnc cccatccagg acagaggccc tcaaccacca caacctgctg gtctgctcgg       420
     tgacagattt ctatccagcc cagatcaaag tccggtggtt tcggaatggc caggaggaga       480
     cagctggcgt tgtgtccacc ccccttatta ggaatggtga ctggaccttc cagatcctgg       540
     tgatgctgga aatgactccc cagcgtggag a                                      571
//