spacer

EBI Dbfetch

ID   U39089; SV 1; linear; genomic DNA; STD; HUM; 202 BP.
XX
AC   U39089;
XX
DT   21-JUN-1996 (Rel. 48, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class II DQ beta chain (HLA-DQB1) gene, exon 3, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-202
RA   Olerup O.H.;
RT   "A novel DQB1*02 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-202
RA   Olerup O.H.;
RT   ;
RL   Submitted (23-OCT-1995) to the INSDC.
RL   Olle H Olerup, Center for BioTechnology, Karolinska Institute, Halsovagen
RL   7-9, Huddinge, S-141 57, Sweden
XX
DR   MD5; 91b90a78a6ca12b8d1b2220c1c6142b8.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Tr; ENST00000415926; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000421888; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
DR   Ensembl-Tr; ENST00000428219; homo_sapiens.
DR   Ensembl-Tr; ENST00000456954; homo_sapiens.
DR   Ensembl-Tr; ENST00000547498; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..202
FT                   /organism="Homo sapiens"
FT                   /isolate="DL-13"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            join(U39090.1:1..269,1..202)
FT                   /gene="HLA-DQB1"
FT   exon            <1..>202
FT                   /gene="HLA-DQB1"
FT                   /number=3
FT   CDS             <1..>202
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II DQ beta chain"
FT                   /note="DQB1*02 allele"
FT                   /db_xref="IMGT/HLA:DQB1*02:03"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q29916"
FT                   /protein_id="AAB02682.1"
FT                   /translation="PSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNGQEETAGVVSTPL
FT                   IRNGDWTFQILVMLEMTPQRG"
XX
SQ   Sequence 202 BP; 45 A; 60 C; 55 G; 42 T; 0 other;
     ccccatccag gacagaggcc ctcaaccacc acaacctgct ggtctgctcg gtgacagatt        60
     tctatccagc ccagatcaaa gtccggtggt ttcggaatgg ccaggaggag acagctggcg       120
     ttgtgtccac cccccttatt aggaatggtg actggacctt ccagatcctg gtgatgctgg       180
     aaatgactcc ccagcgtgga ga                                                202
//


spacer
spacer