spacer

EBI Dbfetch

ID   U39087; SV 1; linear; genomic DNA; STD; HUM; 235 BP.
XX
AC   U39087;
XX
DT   20-NOV-1995 (Rel. 45, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class II antigen (HLA-DRB1*1204) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-235
RX   DOI; 10.1111/j.1399-0039.1996.tb02634.x.
RX   PUBMED; 8896184.
RA   Rodriguez S.G., Crevling C.L., Steiner N., Hurley C.K.;
RT   "Identification of a new allele, DRB1*1204, during routine PCR-SSOP typing
RT   of National Marrow Donor Program volunteers";
RL   Tissue Antigens 48(3):221-223(1996).
XX
RN   [2]
RP   1-235
RA   Hurley C.K.;
RT   ;
RL   Submitted (23-OCT-1995) to the INSDC.
RL   Carolyn K. Hurley, Microbiology & Immunology, Georgetown University School
RL   of Medicine, 3970 Reservoir Rd. N.W., Washington, DC 20007, USA
XX
DR   MD5; f1908342c5343d07d9bc0fc5f28695f8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..235
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="918"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*1204, DRB3*0101, DQB1*0501"
FT                   /clone="DRB1*1204"
FT                   /cell_type="PBL"
FT                   /tissue_type="Blood"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>235
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="DRB1*1204 allele"
FT                   /db_xref="GOA:Q29732"
FT                   /db_xref="IMGT/HLA:DRB1*12:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29732"
FT                   /protein_id="AAB18636.1"
FT                   /translation="EYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVTEL
FT                   GRPDEEYWNSQKDILEDRRAAVDTYCRHNYGAV"
XX
SQ   Sequence 235 BP; 51 A; 54 C; 88 G; 42 T; 0 other;
     gagtactcta cgggtgagtg ttatttcttc aatgggacgg agcgggtgcg gttactggag        60
     agacacttcc ataaccagga ggagctcctg cgcttcgaca gcgacgtggg ggagttccgg       120
     gcggtgacgg agctggggcg gcctgatgag gagtactgga acagccagaa ggacatcctg       180
     gaagacaggc gcgccgcggt ggacacctat tgcagacaca actacggggc tgtgg            235
//


spacer
spacer