spacer

EBI Dbfetch

ID   U38976; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   U38976;
XX
DT   16-NOV-1995 (Rel. 45, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human MHC class I antigen (HLA-C) gene, exons 2 and 3.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Chopek M., Nielsen J., Zhang H.;
RT   ;
RL   Submitted (20-OCT-1995) to the INSDC.
RL   Joe Nielsen, HLA laboratory, American Red Cross, 15601 Crabbs Branch Way,
RL   Rockville, MD 20855, USA
XX
DR   MD5; 7e34ce509dd1ce9e747f0fbc209dc461.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /note="C#40"
FT                   /db_xref="taxon:9606"
FT   gene            1..546
FT                   /gene="HLA-C"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /product="Human MHC molecule"
FT                   /db_xref="GOA:Q29730"
FT                   /db_xref="IMGT/HLA:C*07:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29730"
FT                   /protein_id="AAA81371.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTFQRMYGCDLGP
FT                   DGRLLRGYDQFAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQDRAYLEGTC
FT                   VEWLRRYLENGKKTLQRA"
XX
SQ   Sequence 546 BP; 106 A; 172 C; 197 G; 71 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccc cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg ggtctcacac cttccagagg atgtatggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggtatga ccagttcgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac accgcggctc       420
     agatcaccca gcgcaagttg gaggcggccc gtgcggcgga gcaggacaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaagaag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer