Dbfetch

ID   U38974; SV 1; linear; genomic DNA; STD; HUM; 224 BP.
XX
AC   U38974;
XX
DT   16-NOV-1995 (Rel. 45, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human MHC class II antigen (DRB1) gene, allele 0418, exon 2.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-224
RA   Chopek M., Nielsen J., Zhang H.;
RT   ;
RL   Submitted (20-OCT-1995) to the INSDC.
RL   Joe Nielsen, HLA laboratory, American Red Cross, 15601 Crabbs Branch Way,
RL   Rockville, MD 20855, USA
XX
DR   MD5; ffe52c44f2a76b9b5f5121249cb7f5ec.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..224
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..224
FT                   /gene="DRB1"
FT   CDS             <1..>224
FT                   /codon_start=3
FT                   /gene="DRB1"
FT                   /note="Allele: 0418"
FT                   /db_xref="GOA:Q29728"
FT                   /db_xref="IMGT/HLA:DRB1*04:18"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29728"
FT                   /protein_id="AAA81369.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDA
FT                   EYWNSQKDILEDRRALVDTYCRHNYGVVE"
XX
SQ   Sequence 224 BP; 50 A; 53 C; 81 G; 39 T; 1 other;
     atgagtgtca tttcttcaac gggacggagc gggtgcggtt cctggacaga tacttctatc        60
     accaagagga gtacgtscgc ttcgacagcg acgtggggga gtaccgggcg gtgacggagc       120
     tggggcggcc tgatgccgag tactggaaca gccagaagga catcctggaa gacaggcggg       180
     ccctggtgga cacctactgc agacacaact acggggttgt ggag                        224
//