Dbfetch

ID   U37264; SV 1; linear; genomic DNA; STD; HUM; 249 BP.
XX
AC   U37264;
XX
DT   01-JAN-1996 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class II antigen (HLA-DRB1) gene, exon 2, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-249
RA   Smith A.G., Nelson J.L., Regen, L, Guthrie L.A., Donadi E., Templin D.,
RA   Mickelson E.M., Hansen J.A.;
RT   "Six new DR52-associated DRB1 alleles, three of DR8, two of DR11, and one
RT   of DR6 reflect a variety of mechanisms which generate polymorphism in the
RT   MHC";
RL   Unpublished.
XX
RN   [2]
RP   1-249
RA   Smith A.G., Regen L., Mickelson E., Hansen J.A.;
RT   ;
RL   Submitted (28-SEP-1995) to the INSDC.
RL   Anajane G. Smith, Clinical Immunogenetics, Fred Hutchinson Cancer Research
RL   Center, 1124 Columbia St., Seattle, WA 98104, USA
XX
DR   MD5; 698aef56ee84c39b63ff7bd5045feba5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..249
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /strain="BBD"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>249
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q29725"
FT                   /db_xref="IMGT/HLA:DRB1*14:18"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29725"
FT                   /protein_id="AAA84888.1"
FT                   /translation="EYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTEL
FT                   GRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVVESFTV"
XX
SQ   Sequence 249 BP; 54 A; 56 C; 93 G; 46 T; 0 other;
     gagtactcta cgtctgagtg tcatttcttc aatgggacgg agcgggtgcg gttcctggag        60
     agatacttcc ataaccagga ggagaacgtg cgcttcgaca gcgacgtggg ggagtaccgg       120
     gcggtgacgg agctggggcg gcctgatgct gagtactgga acagccagaa ggacctcctg       180
     gagcggaggc gggccgaggt ggacacctat tgcagacaca actacggggt tgtggagagc       240
     ttcacagtg                                                               249
//