spacer

EBI Dbfetch

ID   U37111; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   U37111;
XX
DT   15-DEC-1995 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human HLA-A24 gene, allele HLA-A*2410, exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1996.tb02697.x.
RX   PUBMED; 9008316.
RA   Gao X., Matheson B.;
RT   "A novel HLA-A*24 (A*2410) identified in a Javanese population";
RL   Tissue Antigens 48(6):711-713(1996).
XX
RN   [2]
RP   1-276
RA   Gao X.;
RT   ;
RL   Submitted (26-SEP-1995) to the INSDC.
RL   Xiaojiang Gao, The Australian National University, Clinical Sciences,
RL   Canberra, Act, Australia, 2601
XX
DR   MD5; c8cc739d8cd510c1303a500ca9016e2f.
DR   Ensembl-Gn; ENSG00000224320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229215; homo_sapiens.
DR   Ensembl-Tr; ENST00000431930; homo_sapiens.
DR   Ensembl-Tr; ENST00000443552; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="JV1458"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(U37110.1:<1..270,1..>276)
FT                   /codon_start=3
FT                   /product="HLA-A24"
FT                   /note="allele HLA-A*2410; also known as HLA-A*24JV"
FT                   /db_xref="GOA:P05534"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*24:10:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:2BCK"
FT                   /db_xref="PDB:3I6L"
FT                   /db_xref="PDB:3NFN"
FT                   /db_xref="PDB:3QZW"
FT                   /db_xref="PDB:3VXM"
FT                   /db_xref="PDB:3VXN"
FT                   /db_xref="PDB:3VXO"
FT                   /db_xref="PDB:3VXP"
FT                   /db_xref="PDB:3VXR"
FT                   /db_xref="PDB:3VXS"
FT                   /db_xref="PDB:3VXU"
FT                   /db_xref="PDB:3W0W"
FT                   /db_xref="PDB:4F7M"
FT                   /db_xref="PDB:4F7P"
FT                   /db_xref="PDB:4F7T"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05534"
FT                   /protein_id="AAA83264.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..276
FT                   /product="HLA-A24"
FT                   /number=3
FT                   /note="allele HLA-A*2410; also known as HLA-A*24JV"
XX
SQ   Sequence 276 BP; 55 A; 80 C; 100 G; 41 T; 0 other;
     gttctcacac cctccagatg atgtttggct gcgacgtggg gtcggacggg cgcttcctcc        60
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg gaggcggccc       180
     atgtggcgga gcagcagaga gcctacctgg agggccggtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//


spacer
spacer