Dbfetch

ID   AH003245; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH003245; U37110-U37111;
XX
DT   08-APR-2016 (Rel. 128, Created)
DT   08-APR-2016 (Rel. 128, Last updated, Version 1)
XX
DE   Homo sapiens isolate JV1458 HLA-A24 gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1111/j.1399-0039.1996.tb02697.x.
RX   PUBMED; 9008316.
RA   Gao X., Matheson B.;
RT   "A novel HLA-A*24 (A*2410) identified in a Javanese population";
RL   Tissue Antigens 48(6):711-713(1996).
XX
RN   [2]
RP   1-646
RA   Gao X.;
RT   ;
RL   Submitted (26-SEP-1995) to the INSDC.
RL   Xiaojiang Gao, The Australian National University, Clinical Sciences,
RL   Canberra, Act, Australia, 2601
XX
DR   MD5; 3f57b8edc09e7f4e9c0d47d4c66cc4a0.
XX
CC   On or before Apr 6, 2016 this sequence version replaced gi:1117834,
CC   gi:1117835, gi:1117836.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="JV1458"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /product="HLA-A24"
FT                   /note="allele HLA-A*2410; also known as HLA-A*24JV"
FT                   /protein_id="AAA83264.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /product="HLA-A24"
FT                   /number=2
FT                   /note="allele HLA-A*2410; also known as HLA-A*24JV"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /product="HLA-A24"
FT                   /number=3
FT                   /note="allele HLA-A*2410; also known as HLA-A*24JV"
XX
SQ   Sequence 646 BP; 110 A; 164 C; 195 G; 77 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac cctccagatg atgtttggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgtggcgga gcagcagaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//