spacer

EBI Dbfetch

ID   U36914; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   U36914;
XX
DT   03-NOV-1995 (Rel. 45, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class I antigen HLA-A (HLA-A) mRNA, exons 2 and 3, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Chopek M., Nielsen J., Zhang H.;
RT   ;
RL   Submitted (22-SEP-1995) to the INSDC.
RL   Joe Nielsen, HLA, American Red Cross, 15601 Crabbs Branch Way, Rockville,
RL   MD 20855, USA
XX
DR   MD5; 5a0215b41c6f03857cd064d2c7a4f342.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen HLA-A"
FT                   /db_xref="GOA:Q29724"
FT                   /db_xref="IMGT/HLA:A*24:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29724"
FT                   /protein_id="AAA80238.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAQSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
XX
SQ   Sequence 546 BP; 111 A; 164 C; 195 G; 76 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccagt cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gttctcacac cctccagatg atgtttggct       300
     gcgacgtggg gtcggacggg cgcttcctcc gcgggtacca ccagtacgcc tacgacggca       360
     aggattacat cgccctgaaa gaggacctgc gctcttggac cgcggcggac atggcggctc       420
     agatcaccaa gcgcaagtgg gaggcggccc atgtggcgga gcagcagaga gcctacctgg       480
     agggcacgtg cgtggacggg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacgg                                                                  546
//


spacer
spacer