spacer

EBI Dbfetch

ID   U36571; SV 1; linear; genomic DNA; STD; HUM; 242 BP.
XX
AC   U36571;
XX
DT   24-OCT-1995 (Rel. 45, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human MHC class II antigen HLA-DRB (HLA-DRB) gene, exon 2, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-242
RA   Chopek M., Nielsen J., Zhang H.;
RT   ;
RL   Submitted (18-SEP-1995) to the INSDC.
RL   Joe Nielsen, HLA, American Red Cross, 15601 Crabbs Branch Way, Rockville,
RL   MD 20855, USA
XX
DR   MD5; 297c6eabe23006da4e075584c6e2af90.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..242
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..242
FT                   /gene="HLA-DRB"
FT   CDS             <1..>242
FT                   /codon_start=3
FT                   /gene="HLA-DRB"
FT                   /product="MHC class II antigen HLA-DRB"
FT                   /db_xref="GOA:Q29719"
FT                   /db_xref="IMGT/HLA:DRB1*08:13"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29719"
FT                   /protein_id="AAA79784.1"
FT                   /translation="LEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTE
FT                   LGRPDAEYWNSQKDLLEDRRALVDTYCRHNYGVGE"
XX
SQ   Sequence 242 BP; 52 A; 55 C; 88 G; 47 T; 0 other;
     tcttggagta ctctacgggt gagtgttatt tcttcaatgg gacggagcgg gtgcggttcc        60
     tggacagata cttctataac caagaggagt acgtgcgctt cgacagcgac gtgggggagt       120
     accgggcggt gacggagctg gggcggcctg atgccgagta ctggaacagc cagaaggacc       180
     tcctggaaga caggcgggcc ctggtggaca cctactgcag acacaactac ggggttggtg       240
     ag                                                                      242
//


spacer
spacer