Dbfetch

ID   U36492; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   U36492;
XX
DT   21-OCT-1995 (Rel. 45, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class I antigen (HLA-B) allele HLA-B-8201 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RX   DOI; 10.1111/j.1399-0039.1996.tb02538.x.
RX   PUBMED; 8740766.
RA   Hurley C.K., Steiner N., Hoyer R.J., Menchaca E., Mitton W., Simonis T.,
RA   Hartzman R.J., Johnson A.H., Ng J.;
RT   "Novel HLA-B alleles, B*8201, B*3515 and B*5106, add to the complexity of
RT   serologic identification of HLA types";
RL   Tissue Antigens 47(3):179-187(1996).
XX
RN   [2]
RP   1-1089
RA   Hurley C.K.;
RT   ;
RL   Submitted (18-SEP-1995) to the INSDC.
RL   Carolyn K. Hurley, Microbiology & Immunology, Georgetown University, 3970
RL   Resevoir Rd. NW, Washington, DC 20007, USA
XX
DR   MD5; 17230f345a5d2d83d4aa0e3c6ad287ff.
DR   H-InvDB; HIT000219455_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /cell_type="B-lymphocyte VWAR"
FT                   /db_xref="taxon:9606"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /number=1
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="allele: HLA-B-8201"
FT                   /db_xref="GOA:Q29718"
FT                   /db_xref="H-InvDB:HIT000219455_03.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*82:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29718"
FT                   /protein_id="AAB18369.1"
FT                   /translation="MRVTAPRTLLLLLWGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQRMFGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEDLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            74..343
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            344..619
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            620..895
FT                   /gene="HLA-B"
FT                   /number=4
FT   exon            896..1015
FT                   /gene="HLA-B"
FT                   /number=5
FT   exon            1016..>1089
FT                   /gene="HLA-B"
FT                   /number=6
XX
SQ   Sequence 1089 BP; 223 A; 334 C; 357 G; 175 T; 0 other;
     atgcgggtca cggcaccccg aaccctcctc ctgctgctct ggggggccct ggccctgacc        60
     gagacctggg ctggctccca ctccatgagg tatttctaca ccgctatgtc ccggcccggc       120
     cgcggggagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc tacaaggccc aggcacagac tgaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     aggatgtttg gctgcgacct ggggcccgac gggcgcctcc tccgcgggca taaccagtta       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcaggac       540
     agagcctacc tggaggacct gtgcgtggag tcgctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt tgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//