spacer

EBI Dbfetch

ID   U35734; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   U35734;
XX
DT   26-APR-1996 (Rel. 47, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class I antigen HLA-B alpha chain (HLA-B-2706 allele) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RX   DOI; 10.1007/BF00176678.
RX   PUBMED; 8550101.
RA   Rudwaleit M., Bowness P., Wordsworth P.;
RT   "The nucleotide sequence of HLA-B*2704 reveals a new amino acid
RT   substitution in exon 4 which is also present in HLA-B*2706";
RL   Immunogenetics 43(3):160-162(1996).
XX
RN   [2]
RP   1-1089
RA   Bowness P., Wordsworth P., Rudwaleit M.;
RT   ;
RL   Submitted (08-SEP-1995) to the INSDC.
RL   Martin Rudwaleit, Nuffield Dept of Medicine, Oxford University, John
RL   Radcliffe Hospital, Oxford, OX3 9DU, UK
XX
DR   MD5; 222e1d595b06252088990ae6dcb23fe4.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
DR   H-InvDB; HIT000219438_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /cell_line="EBC transformed cell line LIE"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B alpha chain"
FT                   /note="HLA-B-2706 allele"
FT                   /db_xref="GOA:P03989"
FT                   /db_xref="H-InvDB:HIT000219438_02.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*27:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1HSA"
FT                   /db_xref="PDB:1JGD"
FT                   /db_xref="PDB:1JGE"
FT                   /db_xref="PDB:1K5N"
FT                   /db_xref="PDB:1OF2"
FT                   /db_xref="PDB:1OGT"
FT                   /db_xref="PDB:1ROG"
FT                   /db_xref="PDB:1ROH"
FT                   /db_xref="PDB:1ROI"
FT                   /db_xref="PDB:1ROJ"
FT                   /db_xref="PDB:1ROK"
FT                   /db_xref="PDB:1ROL"
FT                   /db_xref="PDB:1UXS"
FT                   /db_xref="PDB:1UXW"
FT                   /db_xref="PDB:1W0V"
FT                   /db_xref="PDB:1W0W"
FT                   /db_xref="PDB:2A83"
FT                   /db_xref="PDB:2BSR"
FT                   /db_xref="PDB:2BSS"
FT                   /db_xref="PDB:2BST"
FT                   /db_xref="PDB:3B3I"
FT                   /db_xref="PDB:3B6S"
FT                   /db_xref="PDB:3BP4"
FT                   /db_xref="PDB:3BP7"
FT                   /db_xref="PDB:3CZF"
FT                   /db_xref="PDB:3D18"
FT                   /db_xref="PDB:3DTX"
FT                   /db_xref="PDB:3HCV"
FT                   /db_xref="PDB:3LV3"
FT                   /db_xref="PDB:4G8G"
FT                   /db_xref="PDB:4G8I"
FT                   /db_xref="PDB:4G9D"
FT                   /db_xref="PDB:4G9F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03989"
FT                   /protein_id="AAC50447.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDRESLRT
FT                   LLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPGEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
XX
SQ   Sequence 1089 BP; 217 A; 330 C; 369 G; 173 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctggctccca ctccatgagg tatttccaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacgctgtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tgcaaggcca aggcacagac tgaccgagag       300
     agcctgcgga ccctgctccg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     aatatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggta tgaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcga gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctggggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagccg       900
     tcttcccagt ccaccgtccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtgcagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//


spacer
spacer