spacer

EBI Dbfetch

ID   U34619; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   U34619;
XX
DT   23-SEP-1998 (Rel. 57, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human MHC class I antigen HLA-B35 IEF variant (HLA-B) mRNA, G2997
DE   lymphocytes, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Yang S.Y., Kim C., Kim S.H., Cereb N.;
RT   ;
RL   Submitted (21-AUG-1995) to the INSDC.
RL   Soo Young Yang, Immunology Program, Memorial Sloan-Kettering Cancer Center,
RL   1275 York Ave, Box 41, New York, NY 10021, USA
XX
DR   MD5; ca8a377ac416d057831625b655641b87.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /cell_type="G2997 peripheral lymphocytes"
FT                   /db_xref="taxon:9606"
FT   gene            1..546
FT                   /gene="HLA-B"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B35"
FT                   /note="exons 2 and 3"
FT                   /db_xref="GOA:O78182"
FT                   /db_xref="IMGT/HLA:B*35:43:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O78182"
FT                   /protein_id="AAC35423.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
XX
SQ   Sequence 546 BP; 112 A; 173 C; 191 G; 70 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagtggaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer