spacer

EBI Dbfetch

ID   U34618; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   U34618;
XX
DT   23-SEP-1998 (Rel. 57, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human MHC class I antigen HLA-B35 IEF variant (HLA-B) mRNA, G2744
DE   lymphocytes, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Yang S.Y., Kim C., Kim S.H., Cereb N.;
RT   ;
RL   Submitted (21-AUG-1995) to the INSDC.
RL   Soo Young Yang, Immunology Program, Memorial Sloan-Kettering Cancer Center,
RL   1275 York Ave, Box 41, New York, NY 10021, USA
XX
DR   MD5; b64d18e09260d9ea08d4246ce3e4b2dd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /cell_type="G2744 peripheral lymphocytes"
FT                   /db_xref="taxon:9606"
FT   gene            1..546
FT                   /gene="HLA-B"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen HLA-B35"
FT                   /note="exons 2 and 3"
FT                   /db_xref="GOA:O78183"
FT                   /db_xref="IMGT/HLA:B*35:17:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O78183"
FT                   /protein_id="AAC35422.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQSMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
XX
SQ   Sequence 546 BP; 112 A; 175 C; 187 G; 72 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacat catccagagc atgtacggct       300
     gcgacgtggg gcccgacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer