spacer

EBI Dbfetch

ID   U33329; SV 1; linear; genomic DNA; STD; HUM; 200 BP.
XX
AC   U33329;
XX
DT   03-OCT-1995 (Rel. 45, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human HLA Class II (DQB1-02) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   10-78
RA   Trachtenberg E.A., Keyeux G., Bernal J., Erlich H.A.;
RT   "HLA Class II PCR/SSOP Analysis of Nine Amerindian Tribes and Three African
RT   American Populations From Colombia Reveals Several New Haplotypes and A
RT   Novel DQB1-02 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-200
RA   Trachtenberg E.A.;
RT   ;
RL   Submitted (08-AUG-1995) to the INSDC.
RL   Elizabeth A. Trachtenberg, Roche Molecular Systems, Human Genetics, 1145
RL   Atlantic Ave., Alameda, CA 94501, USA
XX
DR   MD5; b81e932b46d5d117f9e64a0f3d773336.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..200
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="N88"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>200
FT                   /codon_start=3
FT                   /gene="DQB1-02"
FT                   /product="HLA Class II"
FT                   /db_xref="GOA:Q29712"
FT                   /db_xref="IMGT/HLA:DQB1*02:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29712"
FT                   /protein_id="AAA77049.1"
FT                   /translation="FKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGL
FT                   PDAEYWNSQKDILERKRAAVD"
XX
SQ   Sequence 200 BP; 46 A; 47 C; 74 G; 33 T; 0 other;
     agtttaaggg catgtgctac ttcaccaacg ggacagagcg cgtgcgtctt gtgagcagaa        60
     gcatctataa ccgagaagag atcgtgcgct tcgacagcga cgtgggggag ttccgggcgg       120
     tgacgctgct ggggctgcct gacgccgagt actggaacag ccagaaggac atcctggaga       180
     ggaaacgggc ggcggtggac                                                   200
//


spacer
spacer