spacer

EBI Dbfetch

ID   U32661; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   U32661;
XX
DT   16-SEP-1995 (Rel. 45, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class I HLA-B-5104 variant mRNA, exons 2 and 3, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Hurley C.K.;
RT   ;
RL   Submitted (31-JUL-1995) to the INSDC.
RL   Carolyn K. Hurley, Microbiology and Immunology, Georgetown University
RL   School of Medicine, 3970 Resevior Road NW, Washington, DC 20007, USA
XX
DR   MD5; 18d68794b0e1a47b1b18149110a3ddae.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /cell_line="GN097"
FT                   /cell_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /number=2
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /product="MHC class I HLA-B-5104 variant"
FT                   /db_xref="GOA:Q29708"
FT                   /db_xref="IMGT/HLA:B*51:06:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29708"
FT                   /protein_id="AAA75550.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            271..546
FT                   /number=3
XX
SQ   Sequence 546 BP; 115 A; 175 C; 185 G; 71 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aagattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagac acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer