spacer

EBI Dbfetch

ID   U32325; SV 1; linear; genomic DNA; STD; HUM; 254 BP.
XX
AC   U32325;
XX
DT   07-AUG-1995 (Rel. 44, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II HLA-DRB1*1315 gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-254
RA   Hurley C.K.;
RT   ;
RL   Submitted (25-JUL-1995) to the INSDC.
RL   Carolyn K. Hurley, Microbiology & Immunology, Georgetown University School
RL   of Medicine, 3970 Resevoir Rd. N.W., Washington D.C. 20007, USA
XX
DR   MD5; c7b80ce3058c1641247778fea66b64c9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..254
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="HLA-DRB1-15MN/1301 variant, DRB5-0101, DRB3-0202,
FT                   DQA1-0501/0102, DQB1-0301/0602"
FT                   /cell_line="GN070"
FT                   /cell_type="B-Lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>254
FT                   /codon_start=2
FT                   /gene="MHC class II HLA-DRB1*1315"
FT                   /db_xref="GOA:Q29706"
FT                   /db_xref="IMGT/HLA:DRB1*13:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29706"
FT                   /protein_id="AAA93169.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEFRAVT
FT                   ELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFT"
XX
SQ   Sequence 254 BP; 55 A; 59 C; 91 G; 49 T; 0 other;
     tttcttggag tactctacgt ctgagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggagaga tacttccata accaggagga gaacgtgcgc ttcgacagcg acgtggggga       120
     gttccgggcg gtgacggagc tggggcggcc tgatgccgag tactggaaca gccagaagga       180
     catcctggaa gacgagcggg ccgcggtgga cacctactgc agacacaact acggggttgt       240
     ggagagcttc acag                                                         254
//


spacer
spacer