spacer

EBI Dbfetch

ID   AH003186; SV 2; linear; genomic DNA; STD; HUM; 459 BP.
XX
AC   AH003186; U31372-U31373;
XX
DT   01-JUL-2011 (Rel. 109, Created)
DT   01-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens class I major histocompatibility antigen (HLA-Cw3) gene,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   PUBMED; 6609813.
RA   Sodoyer R., Damotte M., Delovitch T.L., Trucy J., Jordan B.R., Strachan T.;
RT   "Complete nucleotide sequence of a gene encoding a functional human class I
RT   histocompatibility antigen (HLA-CW3)";
RL   EMBO J. 3(4):879-885(1984).
XX
RN   [2]
RX   DOI; 10.1084/jem.176.4.937.
RX   PUBMED; 1383381.
RA   Zemmour J., Parham P.;
RT   "Distinctive polymorphism at the HLA-C locus: implications for the
RT   expression of HLA-C";
RL   J. Exp. Med. 176(4):937-950(1992).
XX
RN   [3]
RP   1-459
RX   DOI; 10.1084/jem.181.6.2085.
RX   PUBMED; 7760000.
RA   McCutcheon J.A., Gumperz J., Smith K.D., Lutz C.T., Parham P.;
RT   "Low HLA-C expression at cell surfaces correlates with increased turnover
RT   of heavy chain mRNA";
RL   J. Exp. Med. 181(6):2085-2095(1995).
XX
RN   [4]
RP   1-459
RA   Smith K.D., Lutz C.T.;
RT   ;
RL   Submitted (11-JUL-1995) to the INSDC.
RL   Kelly D. Smith, Pathology, University of Iowa, 200 Hawkins Dr., Iowa City,
RL   IA 52242, USA
XX
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000419135; homo_sapiens.
DR   Ensembl-Tr; ENST00000429840; homo_sapiens.
DR   Ensembl-Tr; ENST00000433153; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
DR   Ensembl-Tr; ENST00000491984; homo_sapiens.
XX
CC   On or before Jun 29, 2011 this sequence version replaced gi:951147,
CC   gi:951148, gi:951149.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..459
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="c42"
FT                   /db_xref="taxon:9606"
FT   gene            1..>459
FT                   /gene="HLA-Cw3"
FT                   /allele="HLA-C-0301"
FT   mRNA            join(1..160,278..>459)
FT                   /gene="HLA-Cw3"
FT                   /allele="HLA-C-0301"
FT                   /product="class I major histocompatibility antigen"
FT   5'UTR           1..87
FT                   /gene="HLA-Cw3"
FT                   /allele="HLA-C-0301"
FT   CAAT_signal     11..15
FT                   /gene="HLA-Cw3"
FT                   /allele="HLA-C-0301"
FT   TATA_signal     35..41
FT                   /gene="HLA-Cw3"
FT                   /allele="HLA-C-0301"
FT   CDS             join(88..160,278..>459)
FT                   /codon_start=1
FT                   /gene="HLA-Cw3"
FT                   /allele="HLA-C-0301"
FT                   /product="class I major histocompatibility antigen"
FT                   /db_xref="GOA:O19656"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:O19656"
FT                   /protein_id="AAA74583.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWD"
FT   exon            88..160
FT                   /gene="HLA-Cw3"
FT                   /allele="HLA-C-0301"
FT                   /number=1
FT   gap             166..265
FT                   /estimated_length=unknown
FT   exon            278..>459
FT                   /gene="HLA-Cw3"
FT                   /allele="HLA-C-0301"
FT                   /number=2
XX
SQ   Sequence 459 BP; 58 A; 126 C; 117 G; 58 T; 100 other;
     tctagagaag ccaatcagcg tctccgcagt cccggttctg aagtccccag tcacccaccc        60
     ggactcagat tctccccaga cgccgagatg cgggtcatgg cgccccgaac cctcatcctg       120
     ctgctctcgg gagccctggc cctgaccgag acctgggccg gtgagnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       240
     nnnnnnnnnn nnnnnnnnnn nnnnntcctc gccccaggct cccactccat gaggtatttc       300
     tacaccgctg tgtcccggcc cggccgcggg gagccccact tcatcgcagt gggctacgtg       360
     gacgacacgc agttcgtgcg gttcgacagc gacgccgcga gtccgagagg ggagccgcgg       420
     gcgccgtggg tggagcagga ggggccggag tattgggac                              459
//


spacer
spacer