Dbfetch

ID   U31334; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   U31334;
XX
DT   24-AUG-1995 (Rel. 44, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class I HLA-B gene (HLA-B*5106 allele), partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RX   DOI; 10.1111/j.1399-0039.1996.tb02538.x.
RX   PUBMED; 8740766.
RA   Hurley C.K., Steiner N., Hoyer R.J., Menchaca E., Mitton W., Simonis T.,
RA   Hartzman R.J., Johnson A.H., Ng J.;
RT   "Novel HLA-B alleles, B*8201, B*3515 and B*5106, add to the complexity of
RT   serologic identification of HLA types";
RL   Tissue Antigens 47(3):179-187(1996).
XX
RN   [2]
RP   1-546
RA   Hurley C.K., Steiner K.N.;
RT   ;
RL   Submitted (10-JUL-1995) to the INSDC.
RL   Carolyn K. Hurley, Microbiology & Immunology, Georgetown University School
RL   of Medicine, 3970 Reservoir Rd. NW, Wasington, DC 20007, USA
XX
DR   MD5; 18d68794b0e1a47b1b18149110a3ddae.
XX
CC   On Mar 30, 1996 this sequence version replaced gi:951143.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="GN088"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA-A24,B5/B5 or 15,78,35,53,Bw4/Bw6,CW6/Cw7"
FT                   /clone="B*5106"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="Blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-B"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="HLA-B protein, allele B51"
FT                   /note="HLA-B*5106 allele"
FT                   /db_xref="IMGT/HLA:B*51:06:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q29701"
FT                   /protein_id="AAB19242.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            271..546
FT                   /gene="HLA-B"
XX
SQ   Sequence 546 BP; 115 A; 175 C; 185 G; 71 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aagattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagac acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//