Dbfetch

ID   U29534; SV 1; linear; genomic DNA; STD; HUM; 252 BP.
XX
AC   U29534;
XX
DT   26-JUL-1995 (Rel. 44, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class II antigen HLA-DP-beta (HLA-DPB1) gene, exon 2, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-252
RX   DOI; 10.1111/j.1399-0039.1996.tb02533.x.
RX   PUBMED; 8851734.
RA   Noble J.A., Cavalli A.S., Erlich H.A.;
RT   "DPB1*5901a: a novel HLA-DPB1 allele from a Caucasian family with
RT   insulin-dependent diabetes mellitus";
RL   Tissue Antigens 47(2):159-162(1996).
XX
RN   [2]
RP   1-252
RA   Noble J.A., Erlich H.A.;
RT   ;
RL   Submitted (19-JUN-1995) to the INSDC.
RL   Janelle A. Noble, Human Genetics, Roche Molecular Systems, 1145 Atlantic
RL   Ave., Alameda, CA 94501, USA
XX
DR   MD5; f72e91623116394945bc320333d437d5.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..252
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="cell lines HB01242, HB01243, HB01244 available
FT                   from the Human Biological Data Interchange (HBDI),
FT                   Philadelphia, PA"
FT                   /note="cloned from PCR amplification products"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>252
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen HLA-DP-beta"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*59:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAB52511.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDLLEEKRAVPDRMCRHNYELGGPMTL"
XX
SQ   Sequence 252 BP; 58 A; 61 C; 92 G; 41 T; 0 other;
     aattaccttt tccagggacg gcaggaatgc tacgcgttta atgggacaca gcgcttcctg        60
     gagagataca tctacaaccg ggaggagttc gtgcgcttcg acagcgacgt gggggagttc       120
     cgggcggtga cggagctggg gcggcctgat gaggagtact ggaacagcca gaaggacctc       180
     ctggaggaga agcgggcagt gccggacagg atgtgcagac acaactacga gctgggcggg       240
     cccatgaccc tg                                                           252
//