Dbfetch

ID   U29241; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   U29241;
XX
DT   10-AUG-1995 (Rel. 44, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class I antigen (HLA-B*8201) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RX   DOI; 10.1111/j.1399-0039.1996.tb02538.x.
RX   PUBMED; 8740766.
RA   Hurley C.K., Steiner N., Hoyer R.J., Menchaca E., Mitton W., Simonis T.,
RA   Hartzman R.J., Johnson A.H., Ng J.;
RT   "Novel HLA-B alleles, B*8201, B*3515 and B*5106, add to the complexity of
RT   serologic identification of HLA types";
RL   Tissue Antigens 47(3):179-187(1996).
XX
RN   [2]
RP   1-546
RA   Hurley C.K.;
RT   ;
RL   Submitted (15-JUN-1995) to the INSDC.
RL   Carolyn K. Hurley, Microbiology & Immunology, Georgetown University School
RL   of Medicine, 3970 Reservoir Rd. NW, Washington, DC 20007, USA
XX
DR   MD5; fedf7f54d26f2a29fc17379c57bc0ecc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="MAME; MAMA; MAPA"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="MAME & MAMA-A34,B-,CW3,DR15,DQ1"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-B*8201"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B*8201"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q29718"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*82:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29718"
FT                   /protein_id="AAC50691.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQRMFGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEDLC
FT                   VESLRRYLENGKETLQRA"
FT   exon            271..546
FT                   /gene="HLA-B*8201"
XX
SQ   Sequence 546 BP; 112 A; 171 C; 190 G; 73 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtttggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggcataa ccagttagcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcaggacaga gcctacctgg       480
     aggacctgtg cgtggagtcg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//