Dbfetch

ID   U27268; SV 1; linear; genomic DNA; STD; MUS; 8778 BP.
XX
AC   U27268;
XX
DT   31-AUG-1995 (Rel. 45, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 3)
XX
DE   Mus musculus pre-T cell receptor alpha gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-8778
RX   DOI; 10.1007/BF00176445.
RX   PUBMED; 7672822.
RA   Fehling H.J., Laplace C., Mattei M.G., Saint-Ruf C., von Boehmer H.;
RT   "Genomic structure and chromosomal location of the mouse pre-T-cell
RT   receptor alpha gene";
RL   Immunogenetics 42(4):275-281(1995).
XX
RN   [2]
RP   1-8778
RX   DOI; 10.1126/science.7973703.
RX   PUBMED; 7973703.
RA   Saint-Ruf C., Ungewiss K., Groettrup M., Bruno L., Fehling H.J.,
RA   von Boehmer H.;
RT   "Analysis and expression of a cloned pre-T cell receptor gene";
RL   Science, e1252229 266(5188):1208-1212(1994).
XX
RN   [3]
RP   1-8778
RA   Fehling H.J.;
RT   ;
RL   Submitted (18-MAY-1995) to the INSDC.
RL   Hans Jorg Fehling, Basel Institute for Immunology, Grenzacherstrasse 487,
RL   Basel, CH 4005, Switzerland
XX
DR   MD5; d1916587b1265719438c67eea99f3567.
DR   EuropePMC; PMC155334; 11825871.
DR   EuropePMC; PMC1829386; 17332745.
DR   EuropePMC; PMC2193489; 11581319.
DR   IMGT/LIGM; U27268.
DR   RFAM; RF00005; tRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8778
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /map="17D/E1"
FT                   /strain="129/Ola and 129/Sv"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             join(604..661,5538..5858,7342..7386,8004..8179)
FT                   /codon_start=1
FT                   /product="pre-T cell receptor alpha"
FT                   /db_xref="GOA:P0C6B2"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027834"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="MGI:MGI:104857"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C6B2"
FT                   /protein_id="AAA84398.1"
FT                   /translation="MARTWLLLLLGVRCQALPSGIAGTPFPSLAPPITLLVDGRQHMLV
FT                   VCLVLDAAPPGLDNPVWFSAGNGSALDAFTYGPSLAPDGTWTSLAQLSLPSEELEAWEP
FT                   LVCHTRPGAGGQNRSTHPLQLSGESSTARSCFPEPLGGTQRQVLWLSLLRLLLFKLLLL
FT                   DVLLTCSHLRLHVLAGQHLQPPPSRKSLPPTHRIWT"
FT   sig_peptide     604..651
FT   mat_peptide     join(652..662,5538..5858,7342..7386,8004..8176)
FT                   /product="T cell receptor alpha"
FT   regulatory      8701..8710
FT                   /note="provided by B2 repeat"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 8778 BP; 2192 A; 2152 C; 2183 G; 2251 T; 0 other;
     aagctttgga tctggaggat gacaggaaga gctgcacgtg gagtcccgcc atcccatccc        60
     cctggaactc tgtccagtgg atggcaattg ctctcaagta gagcgaagga actaggcttg       120
     ggaaaggctt tgagaatctg gggttgcaca cacttttgat cccagccagc actctggagg       180
     cagaggcggg tggatatctg tgatttggag gccagcctga tttacatagt gagttccatg       240
     caagtccggt ccacacagca gagaccttgt ctcacacaga ggagcctctg gggcctgtga       300
     agtgctcttc agacagggag gaggttatga gagggtgggc acccagcccc tgggatggga       360
     gtgggacctg agttccctgg cacccctcct ccccagaaag cactgggaac tagggggtag       420
     agcagagcag ctggggtaca gctgggtctg tgatctggga agcagtgtag gggagccttc       480
     tgccctagcc cacacctcag agctgcagct gggcctgtgg cctgggaggc agactagcag       540
     agcctcctcc cccaacaggt agctcctggc tgcaactggg tcatgcttct ccacgagtgg       600
     gccatggcta ggacatggct gctgctgctt ctgggcgtca ggtgtcaggc cctaccatca       660
     ggtatgtccc tcttgcctcc ctatttggct ctcactgagt tcatcccctg gtaccagctg       720
     agcctctaca gcgatgagtg ggctccatgg ccctagggtt ctgaggtctc atgtccttct       780
     ccagaaggac atgctgttgt tttgttttgt tttctgagac agggtttctc tgtgtagctc       840
     cggctgtcct ggaactcact ctgtagacca ggctggcctc gaactcagaa atccacctgc       900
     ctctgcctcc caagtgctgg gattaaaggt gtgcgccaac actgcccgga ctactctaac       960
     cttctctctg tcctatccag tgttgggggt tggaagggag gtagaggcca gctggcctgg      1020
     gctttgggac agaagtgctt ggggtgggga gaaacaatct gggaggcttt acagagaaac      1080
     cgaatcaatt caggaggctg agagtcctgg ggtcactccc agccttctcc agttctgttg      1140
     tttacaaggc cttagtaata ttaacacaaa tactatttcc caagcttagg cgggagggat      1200
     ggctcattgg ttaagagcac tggctgctct tccagaggtc ctgagttcaa atcccagcaa      1260
     ccacaaccat ctgtgatgga atccgagaac actcatatac ataaaataaa tcttaaaaaa      1320
     aagaaagatt atttccaaag cttacttacc aaagaattac attatcttta ctcttcacaa      1380
     cattcctatt gggcaattat cgggagattt ggacctcgat caattaaggg gattgagtca      1440
     ggggccaacc tcggctctgt ctgaggcctt gtcctacact tggcccacta tgtcacatgg      1500
     caaaattttg gacattcttc aaggcaaaaa agacagattt gtggtcacag aggctccagt      1560
     gagcatgctc actggaggtg tgctccgtgt tcctacacca gtcatttggc cacctaatac      1620
     cttcatctga tcttccccat ttctctggca ccctgggcat ctctttatct tggccacaca      1680
     agagtgcata gtgtcaattt atttccagtt gctaatattg gggattttac ttacattgca      1740
     gaagcacaga tctgactctg caggttgaac tctgatcccc ccaggcgcat gctccactgg      1800
     cacccagtct cttctctctc tcacacacac aaagtaaatt ttgttgttgt tgtttttacg      1860
     acaaggtttc tctgtgtagc cctggctgtc ctggaactca ctctatagac caggctggcc      1920
     ttgaactcag agatctgcct gcctctgcct cttgagtgct gggattaaaa gtatgtatca      1980
     acatagcctg acatacaaag tacctttttt tgttttttaa atattataaa gggctggtga      2040
     gatggctcag tgggtaggag cacccgactg ctcttccgaa ggtccggagt tcaaatccca      2100
     gcaaccacat ggtggctcac aaccatctgt aacaagatct gatgccctct tctggagtgt      2160
     ctgaggacag ctacagtgta cttacatata atgaataaat aaatctttaa aaaaaaaaca      2220
     aataaatatt ataagaacat aattattttt taagatttat ttattttatg tttatgagta      2280
     cacactgtag ctgtacagat agttgtgagc cttcatctgg ttgttaggaa ttgaatttag      2340
     gacctctggt ctctctggtc aactctgctc gctcaggccc aaagatttat tcattattat      2400
     aattaagtac actgtagctg tcttcagaca caccagaaga gggcgtcaga tctcattacg      2460
     ggtggttgtg agccaccatg tggttgctgg ggttcagacc ttcagaggag cagcagtcag      2520
     tgctcttaac caccgagcca tctcaccagc cccaagaaca taatttttaa aaatatattt      2580
     atttgtttaa tgagtactta tgagaatata tgagtacgct gtcattgtct tcagacacac      2640
     tagacgaggg cataggattc cattacagat tgaagtgttg ggtgtgtagg cgctgggaat      2700
     tgaacccagg acctctggaa gagcagccag tgctcttaac tgctgaacca tctccccagc      2760
     ccagtatatg ttttcttaag agaaggaata agtggggcta gagcaatggc ttactggtta      2820
     agagtgctgg ctgctcttcc agaggatctg agtttcattc ccagccccta catggtgact      2880
     cacaaccacc tatgactcca atcccagggt atctgatgtc cctttgtggt ctgtgcaagc      2940
     actgcttgtg tgtggggcat ggacagactt gctgtcaaaa cactcataga tgtaaagtta      3000
     aataaaatct agggaaaaaa attaaaaata gagtaagact ccaagccggg gccgggggtg      3060
     ggggcggggc acagctctgt tgagagttca atccccagca ctgggcttgt cctgtgctaa      3120
     atcttcaggg tgtgcacatg cctgtaatcc aaactctgta aactctggag gtggagccag      3180
     gagggtccag aattcaaagt gatccttggc tgcatgggaa gtctgaggcc agcctgggct      3240
     acctagtaaa aggtctcaaa accaagccga gcgtggtggt gcacgacttt aatcccagca      3300
     ctcgggaagc tgaggcaggt ggaatttctg agttcgaggc cagcctggtc tacaaaacaa      3360
     agtgagttcc aggacagcca gggctacaca gagaaaccct gtctcaaaaa acaaaaacaa      3420
     aacaaaaaag tctcaaaatc aaaccacaat gaaatagaat aaaagtcaga tttgaatatg      3480
     ggaaaaggtt aaccatttgt taacttatat tattgctagc tcactcctgt agggcgatat      3540
     tattctgtct tctcatctca ccgcggtgct aggaaccaat cccagggctt cctgtgttaa      3600
     agagaagcat ccttccactg catttcatcc cttcctcctt ttgtttacat taatttttac      3660
     atttcctgta tatgcacggg gtgggtgcat gagtctggca gtcataggac aactttcagg      3720
     agtcaggttt ttgtcttcta ccaggaaggc tcctaggttt gaactcagat gtggaaatgc      3780
     acccttactc agtgaggcat ctggtcagct cccatttcat acagctcagc ttaaccctgc      3840
     ctgacgccat acagctcacc caccaggctt cagtctccta cgttctggga ttacagacat      3900
     ggatagcctc atcagacttc ctctgctctc aggccaggca ctcctcctcc gtcctcccca      3960
     tagaggcatc agctctcctc aggcagcaca acatggtact ataaccactt gtttatgaag      4020
     ctaatgcctt tcccacagga cgaagttcct cgacagccca ggcagtgtct ttctcagttt      4080
     tctataccca ggtggcagag gaaggagttg ctgggccgtg gtggcacaca gctttaatcc      4140
     tagcttgtga gacgcacagg caggaagatc tctgagttcg agtttagcct gatctgtgaa      4200
     gccagggcta cagagagaaa tcatgtctca gaaggggtgg gggtgggggt ggggctcaga      4260
     aagaatagac ggacagacca gtggacgatg gaggatggat gaattatagg agaaaggtgg      4320
     agatggctgg gtgagtcaga actctggcta cacaatcatg aggacctgag ttcaaatcct      4380
     cagcacccat ttgaaaaact gtgcattgct ctaagtgtgc ttgtaatccc agcactggac      4440
     tgagccaaga catgaggatc acactggggg cttgctggat gcaggcctag ctccaggtgc      4500
     agtgagagac ccggtcctaa gagaacaaag ggacagatga tgatagaaca ggtcagttaa      4560
     tatcctcctc gggtctccac gcacaaatat atcgcatgta tgcacacaca cacacacaca      4620
     cacacatgaa gtagaaacct aagggtgctt tgaaaagtca gctgtgttgg gtggttctgt      4680
     taaagcaagc acatgaaagg acacgtgagg taggactctt tgctaaggac acacatgtat      4740
     tggtctgcct tacattgtgt agttgagctc catttgttgg gtctctataa agagaaatgc      4800
     attaagaaac ttctggtggc tgggcagtgg tggcgcacac cttaatccca gcactcggga      4860
     ggcagaggca ggcagatttc tgagttcaag gccagcctgg tctacagagt gagttccagg      4920
     acagccaggt cagaaactct gtcttgaaaa accaaaaaca aacaaacaaa caaacaaaca      4980
     aaaaagaaag aaagaaagaa agggagatgt tggctggact ctgtacctgg gtaccctgtg      5040
     gttttcttct tctacccttc tccacccttt cgacccctaa cactacatag gagagaaaaa      5100
     aaaataggaa agagggttgg atgttattgt tactactcct gattgtgttg gttaggggca      5160
     tcaagttggg gcaagtttga tcttcaccat caggatatct aatttcttct tttgctttct      5220
     tctttgccca cgactactta gcaagccaag actgacagca accaactaac aaccgcccac      5280
     ccaccaacaa cccaccccat ctctcggagc cctagcatcc atacaccctc taaaaactcc      5340
     tcagagttcc aaccgtcaca cagtcgcaga aattatcttc agctggccaa actaggcccc      5400
     tgctggagca gaggcaaacc gtagtcagct gctgcagaca atctgaagca gcccccacgc      5460
     ccccaaacct gggattaaaa cgaaagcgca ttcctatttc tgtgttttta aagagatcaa      5520
     aattctcact cttgcaggca tcgctggcac cccctttccg tctctggctc cacccatcac      5580
     actgctggta gatggaaggc agcacatgct ggtggtttgc ctggtcctcg atgcggcacc      5640
     ccctggcctt gacaaccctg tctggttctc agctggcaat ggcagtgccc tagacgcctt      5700
     cacctatggg ccctctctgg caccggacgg cacctggact agcctggccc agctctcctt      5760
     gccttctgaa gagctggaag cctgggagcc cttggtctgt cacaccaggc ctggggctgg      5820
     gggacagaac cggagcacac accccctcca gctgtcaggt gggggatgga gcctggggac      5880
     ctttcctttt ccataccatg gggccaggat atgttgggga gcctgtctac acttccccca      5940
     gtgctggatt ataaatatgg gctaccatta cctgtttgct tgcttgcttg cttgcttgtt      6000
     ggtaggcact gggcatgtaa gggtagaccc tggctcctgt aagtggctcg aggccataat      6060
     tcctgggctt tgcagctgag atacatggtt caggttatct cttgagcctg taatcccagc      6120
     agaagaggaa ggaggatctc tctgagttca aagctatcct tggctacata gtgagttcaa      6180
     ggcctgcttg ggctacagga gaccttgtct caaaaatcaa agcaaaagca actctaggct      6240
     ctgatctgtg tttgctaaga gctattaata gctttcagtg gctcattcat aggtgcacat      6300
     atacacatgt ttatatatgt aatctataga aacagttcat atacatgtaa acaaagcctg      6360
     caagaccaaa caataactaa agaacaagcc ccccacattt accaacttta ctctgtggca      6420
     aacgctgttc taaatgtttc attttcattt tatttttatt atttatttat ctatttagtt      6480
     agttagttag ttttccaaga caaggtttat cacagtttct ctgtgtagcc ctggctgtct      6540
     tggaactcac tctgtagacc aggctggcct tgaactcaca gaaatcctcc ttcctacctc      6600
     tgcctcctga gttctgggat taaaagtgtg catcaccatg ccctgctcct agctttttag      6660
     tgaggatgct ggggatccaa ttcaggaaag ctctttacca gctaagcctt ctcagccgag      6720
     cagatgaggc cggctaacca gtgagcccaa agggtctgcc tgtctacact tcccccagtg      6780
     ctggattata aatatggact accattacct gtttgcttgc ttggttgttt gtttgggggg      6840
     ggggggttcg agtatagccc tggctatcct agaactcact ttgtagacca ggctggcctc      6900
     gaactcagaa atccgcctgc ctctgcctcc cgagtggttt ttgttgtttt ttgagacagg      6960
     tttttaatct gtgtagccct gcctgttgtg tttctttttt caaacatggg tcctggggat      7020
     agagctcagg tcctttgcat gtatagcaag cactgtcatg actgagcatt tggggtcacc      7080
     tcagtagtgc cctgcctaca gcagaagctg taaaagaata ggttccgtgt gtgtgtgtgt      7140
     gtgggggggg gactgccata cctcttaggg ctgtcaggca gggaggtggg gaatggctgc      7200
     tcaggacttg ctaacaagtg ggctcagggt ctccacacat gtccaatatg tcctgcgggt      7260
     tgaccagggc tcgacgcagg gcaggggctg agaggtgctc gccctccctg tagccctcac      7320
     tcctttcttc ttgactcaca ggggaatctt cgacagccag gagctgcttt ccggagcctc      7380
     tcgggggtaa gtcaccagtg ggtgagggag ggacggtggc tgggaacaag aatctcagca      7440
     ctggtacccg gcaggtagca ttcagctcta attcaaccat aggtcccatg cggttgctgc      7500
     tggaggactg agaagtttcc agtaagggga ctgccttgct tggggctagg ctgggtttca      7560
     gccttccctg ggataaggtg gggatttatt tctggactgc agtggagcag tgcagaggag      7620
     agctaaaata agggtctaat ggctccttgg taggggggtg acaagcagtc ttggtatgaa      7680
     agcctctgtg ttatttgatt ccctgaggtg ctagaggagc actggctaat aatcccctcg      7740
     tccatttctt gcccagagac actgcactat ttattctttg catcagaagc tcgttcctgc      7800
     agcttgcctc cccgccaaat aaaataaata aaatgagggc taagcgggaa gaaggcacta      7860
     attattacca gtagaaacta aggtcagata ccaggaaaga agttccttgg agaaggaggt      7920
     ggaaagagag agtggccaac acggagaact ggctctccct gttgtgggct cctggggact      7980
     cctcatggct ccttcttctg cagggacaca gcggcaggta ctgtggctga gcctactgcg      8040
     cctgctcctc ttcaaactgc ttctgctcga tgtgctcctg acctgcagcc acctccgcct      8100
     ccatgtgctg gcgggccagc acctccagcc accaccctca cgcaagtccc tgcctcccac      8160
     ccacagaatt tggacatagt tatgagtctc tgagcttaga tcttacccac ccctctgagc      8220
     ccagggtggt ggtgatgctg gacactactg ctccctgggg ccaggaagaa caaagcccag      8280
     gctgtgagga agccagctgg gcccagaact cacgatcccc cctcagtgct ccttgttcaa      8340
     agtgggggtt tctttttgct ttttctgtat gtgatctgcc tcttgtaaat ggagctatcc      8400
     tatcagagac tgggctcttg tctctcctat cagactgaga ctttgggaag aaaaggactg      8460
     tgtctctgtc agacagggca ggaggatgca cctggtaact gggcacaata caaaagtctt      8520
     ataaaacaca ggcatgtcgg gctggtgaga cggctcagtg gttaagagca ctgactactc      8580
     ttccaaaggt cctgagttca aatcccagca accacatggt ggctgacaac catccgtaac      8640
     aagatctgat gccctcttct ggtgtgtctg aagacagcta cattgtactt acatatagta      8700
     aataaataaa tcttttaaaa aaacaaaaaa caacaacaac aacaacaaaa aaaaaaccac      8760
     aggcatgtca caaagctt                                                    8778
//