spacer

EBI Dbfetch

ID   U26558; SV 1; linear; genomic DNA; STD; HUM; 239 BP.
XX
AC   U26558;
XX
DT   29-JUN-1995 (Rel. 44, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class II HLA DRB1 gene, exon 2, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-239
RA   Smith A.G., Nelson J.L., Hansen J.A.;
RT   "Five new DRB1 alleles, three of DR8 and two of DR11, detected by PCR/SSOP
RT   typing and characterized by DNA sequencing";
RL   Unpublished.
XX
RN   [2]
RP   1-239
RA   Smith A.G., Nelson J.L., Hansen J.A.;
RT   ;
RL   Submitted (08-MAY-1995) to the INSDC.
RL   Anajane G. Smith, Clinical Immunogenetics, Fred Hutchinson Cancer Research
RL   Center, 1124 Columbia St., Seattle, WA 98104 USA
XX
DR   MD5; 6953ad47e5b5c1a8e9f2d8d932e2429a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..239
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            <1..>239
FT                   /gene="MHC Class II HLA DRB1"
FT                   /number=2
FT                   /note="35 bp upstream exon 2 not shown; sequence begins
FT                   with codon 12"
FT   gene            1..239
FT                   /gene="MHC Class II HLA DRB1"
FT   CDS             <1..>239
FT                   /codon_start=3
FT                   /gene="MHC Class II HLA DRB1"
FT                   /db_xref="GOA:Q29691"
FT                   /db_xref="IMGT/HLA:DRB1*11:19:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29691"
FT                   /protein_id="AAA67957.1"
FT                   /translation="SECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPD
FT                   EEYWNSQKDILEDRRAAVDTYCRHNYGVGESFTV"
XX
SQ   Sequence 239 BP; 53 A; 54 C; 88 G; 44 T; 0 other;
     cgtctgagtg tcatttcttc aatgggacgg agcgggtgcg gttcctggac agatacttct        60
     ataaccaaga ggagtacgtg cgcttcgaca gcgacgtggg ggagttccgg gcggtgacgg       120
     agctggggcg gcctgatgag gagtactgga acagccagaa ggacatcctg gaagacaggc       180
     gggccgcggt ggacacctac tgcagacaca actacggggt tggtgagagc ttcacagtg        239
//


spacer
spacer