Dbfetch

ID   U25971; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   U25971;
XX
DT   31-JUL-1995 (Rel. 44, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human MHC class I antigen HLA-A2407 (HLA-A) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RA   Selvakumar A.;
RT   "Molecular Characterization HLA-A*24 Alleles and Definition of A*2407";
RL   Unpublished.
XX
RN   [2]
RP   1-1098
RA   Selvakumar A.;
RT   ;
RL   Submitted (01-MAY-1995) to the INSDC.
RL   Annamalai Selvakumar, Human Immunogenetics, Sloan Kettering Institute, 1275
RL   York Avenue, New York, NY 10021, USA
XX
DR   MD5; 84567594bbce6af8cdff02a53fe08efc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1098
FT                   /gene="HLA-A"
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen HLA-A2407"
FT                   /db_xref="GOA:Q29689"
FT                   /db_xref="H-InvDB:HIT000218780.14"
FT                   /db_xref="IMGT/HLA:A*24:07:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q29689"
FT                   /protein_id="AAA73518.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAQSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 1098 BP; 223 A; 331 C; 364 G; 180 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg caggctccca ctccatgagg tatttctcca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggacgagga gacagggaaa gtgaaggccc agtcacagac tgaccgagag       300
     aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccggttctca caccctccag       360
     atgatgtttg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta ccaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aaagaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac caagcgcaag tgggaggcgg cccatgtggc ggagcagcag       540
     agagcctacc tggagggcac gtgcgtggac gggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ctctgagatg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc ttgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcagct gtggtggtac cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagcca       900
     tcttcccagc ccaccgtccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgctgtg atgtggagga ggaacagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//