spacer

EBI Dbfetch

ID   U25639; SV 1; linear; genomic DNA; STD; HUM; 228 BP.
XX
AC   U25639;
XX
DT   19-MAY-1995 (Rel. 43, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II antigen HLA-DRB1 gene (HLA-DRB1-1114 allele), partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-228
RX   DOI; 10.1007/BF00179412.
RX   PUBMED; 7590984.
RA   Heron S., McKeen M., Cizman B., Kearns J., Argyris E., Wu J., Griffith B.,
RA   Kamoun M., Zmijewski C., Bunin N., Monos D., Williams T.;
RT   "Identification of HLA-DRB1(*)1114 by oligonucleotide typing and DNA
RT   sequencing";
RL   Immunogenetics 42(5):436-437(1995).
XX
RN   [2]
RP   1-228
RA   Monos D.S., Argyris E.G.;
RT   ;
RL   Submitted (24-APR-1995) to the INSDC.
RL   Elias G. Argyris, Path. & Lab. Med., Univ. of Pennsylvania Medical School,
RL   3400 Spruce Str., Philadelphia, PA 19104, USA
XX
DR   MD5; bb6c32f8f70b20af31ba3b8bef2319e1.
XX
CC   On Jun 12, 1996 this sequence version replaced gi:808101.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..228
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR product from genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>228
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DRB1-1114 allele"
FT                   /db_xref="GOA:Q29688"
FT                   /db_xref="IMGT/HLA:DRB1*11:14:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29688"
FT                   /protein_id="AAB02173.1"
FT                   /translation="SECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPD
FT                   EEYWNSQKDILEDERAAVDTYCRHNYGVGE"
XX
SQ   Sequence 228 BP; 51 A; 50 C; 86 G; 41 T; 0 other;
     gtctgagtgt catttcttca atgggacgga gcgggtgcgg ttcctggaca gatacttcta        60
     taaccaagag gagtacgtgc gcttcgacag cgacgtgggg gagttccggg cggtgacgga       120
     gctggggcgg cctgatgagg agtactggaa cagccagaag gacatcctgg aagacgagcg       180
     ggccgcggtg gacacctact gcagacacaa ctacggggtt ggtgagag                    228
//


spacer
spacer