spacer

EBI Dbfetch

ID   U25638; SV 1; linear; genomic DNA; STD; HUM; 228 BP.
XX
AC   U25638;
XX
DT   19-MAY-1995 (Rel. 43, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class II antigen HLA-DRB1 gene (HLA-DRB1-1316 allele), partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-228
RA   Monos D.S., Argyris E.G.;
RT   ;
RL   Submitted (24-APR-1995) to the INSDC.
RL   Elias G. Argyris, Path. & Lab. Med., Univ. of Pennsylvania Medical School,
RL   3400 Spruce Str., Philadelphia, PA 19104, USA
XX
DR   MD5; 074f02066c13342b742673777ee55c90.
XX
CC   On Jun 12, 1996 this sequence version replaced gi:808099.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..228
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR product from genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>228
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DRB1-1316 allele"
FT                   /db_xref="GOA:Q29687"
FT                   /db_xref="IMGT/HLA:DRB1*13:16"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29687"
FT                   /protein_id="AAB02172.1"
FT                   /translation="SECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPD
FT                   AEYWNSQKDILEDERAAVDTYCRHNYGVDE"
XX
SQ   Sequence 228 BP; 51 A; 53 C; 85 G; 39 T; 0 other;
     gtctgagtgt catttcttca atgggacgga gcgggtgcgg ttcctggaca gatacttcca        60
     taaccaggag gagaacgtgc gcttcgacag cgacgtgggg gagttccggg cggtgacgga       120
     gctggggcgg cctgatgccg agtactggaa cagccagaag gacatcctgg aagacgagcg       180
     ggccgcggtg gacacctact gcagacacaa ctacggggtt gatgagag                    228
//


spacer
spacer