spacer

EBI Dbfetch

ID   U25442; SV 1; linear; genomic DNA; STD; HUM; 228 BP.
XX
AC   U25442;
XX
DT   05-JUL-1995 (Rel. 44, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class II antigen HLA-DRB1 (HLA-DRB1*1120 allele) gene, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-228
RX   DOI; 10.1111/j.1399-0039.1996.tb02605.x.
RX   PUBMED; 8864175.
RA   Cizman B.B., Kearns D.J., McKeen M.E., Heron S.D., Wu J., Griffith B.B.,
RA   Argyris E.G., Kamoun M., Zmijewski C.M., Williams T.M., Monos D.S.;
RT   "New DRB1*1120 allele; another example of the transition between the DR11
RT   and DR13 families of alleles";
RL   Tissue Antigens 48(1):52-54(1996).
XX
RN   [2]
RP   1-228
RA   Argyris E., Monos D.S.;
RT   ;
RL   Submitted (21-APR-1995) to the INSDC.
RL   Path. & Lab. Med., University of Pennsylvania Medical School, 3400 Spruce
RL   Street, Philadelphia, PA 19104, USA
XX
DR   MD5; 797759e193ff1bc9fe52100e7ba4afa0.
XX
CC   On Mar 14, 1997 this sequence version replaced gi:886747.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..228
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>228
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DRB1*1120 allele"
FT                   /db_xref="GOA:Q29686"
FT                   /db_xref="IMGT/HLA:DRB1*11:20"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29686"
FT                   /protein_id="AAB50934.1"
FT                   /translation="SECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPD
FT                   EEYWNSQKDILEDERAAVDTYCRHNYGVGE"
XX
SQ   Sequence 228 BP; 51 A; 51 C; 87 G; 39 T; 0 other;
     gtctgagtgt catttcttca atgggacgga gcgggtgcgg ttcctggaca gatacttcca        60
     taaccaggag gagaacgtgc gcttcgacag cgacgtgggg gagttccggg cggtgacgga       120
     gctggggcgg cctgatgagg agtactggaa cagccagaag gacatcctgg aagacgagcg       180
     ggccgcggtg gacacctact gcagacacaa ctacggggtt ggtgagag                    228
//


spacer
spacer