spacer

EBI Dbfetch

ID   U24261; SV 1; linear; mRNA; STD; HUM; 1098 BP.
XX
AC   U24261;
XX
DT   04-MAY-1995 (Rel. 43, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class I antigen HLA-A30 (HLA-A-3004 allele) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   DOI; 10.1111/j.1399-0039.1995.tb03133.x.
RX   PUBMED; 8838350.
RA   Lienert K., Russ G., Bennett G., Gao X., McCluskey J.;
RT   "HLA-A*3004: a new A30 allele identified in an Australian Caucasoid
RT   population";
RL   Tissue Antigens 46(5):394-397(1995).
XX
RN   [2]
RP   1-1098
RA   Lienert K.K., Gao X., McCluskey J.;
RT   ;
RL   Submitted (10-APR-1995) to the INSDC.
RL   Kristin K. Lienert, Transplant Immunology Lab, The Queen Elizabeth
RL   Hospital, Woodville Rd, Woodville, Adelaide, SA 5011, Australia
XX
DR   MD5; 3b466dddbc4630cc32add743a043b963.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="mRNA"
FT                   /cell_line="EBV-transformed lymphoblastoid cell line
FT                   AD7563"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /gene="HLA-A30"
FT                   /product="MHC class I antigen HLA-A30"
FT                   /note="HLA-A-3004 allele"
FT                   /db_xref="GOA:P16188"
FT                   /db_xref="H-InvDB:HIT000218741.14"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*30:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /protein_id="AAB50434.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFSTSVSRPGSGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQTDRENLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
XX
SQ   Sequence 1098 BP; 224 A; 328 C; 365 G; 181 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttctcca catccgtgtc ccggcccggc       120
     agtggagagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagagg       240
     cctgagtatt gggaccagga gacacggaat gtgaaggccc actcacagac tgaccgagag       300
     aacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     ataatgtatg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta tgaacagcac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccatgtggc ggagcagtgg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagctg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgccgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagtt acactcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer