spacer

EBI Dbfetch

ID   U24179; SV 1; linear; genomic DNA; STD; HUM; 260 BP.
XX
AC   U24179;
XX
DT   01-JAN-1996 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human MHC class II HLA DRB1 gene, DR8 allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-260
RX   DOI; 10.1111/j.1399-0039.1996.tb02616.x.
RX   PUBMED; 8883301.
RA   Smith A.G., Nelson J.L., Regen L., Guthrie L.A., Donadi E., Mickelson E.M.,
RA   Hansen J.A.;
RT   "Six new DR52-associated DRB1 alleles, three of DR8, two of DR11, and one
RT   of DR6, reflect a variety of mechanisms which generate polymorphism in the
RT   MHC";
RL   Tissue Antigens 48(2):118-126(1996).
XX
RN   [2]
RP   1-260
RA   Smith A.G., Nelson J.L., Hansen J.A.;
RT   ;
RL   Submitted (05-APR-1995) to the INSDC.
RL   Anajane G. Smith, Clinical Immunogenetics, Fred Hutchinson Cancer Research
RL   Center, 1124 Columbia Street, Seattle, WA 98104 USA
XX
DR   MD5; 52f609bb8a928e2971feb2c646aed3d5.
XX
CC   On Mar 12, 1996 this sequence version replaced gi:1142672.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..260
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>260
FT                   /codon_start=3
FT                   /gene="MHC class II HLA DRB1"
FT                   /note="DR8 allele"
FT                   /db_xref="GOA:Q29685"
FT                   /db_xref="IMGT/HLA:DRB1*08:14"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29685"
FT                   /protein_id="AAA91986.1"
FT                   /translation="RFLEYSRGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEDRRALVDTYCRHNYGVGESFTV"
XX
SQ   Sequence 260 BP; 57 A; 59 C; 93 G; 51 T; 0 other;
     cacgtttctt ggagtactct aggggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg                                                   260
//


spacer
spacer