Dbfetch

ID   AH005195; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH005195; U18988; U19734;
XX
DT   07-JUL-2011 (Rel. 109, Created)
DT   07-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen HLA-A30 (HLA-A30) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.1995.tb03133.x.
RX   PUBMED; 8838350.
RA   Lienert K., Russ G., Bennett G., Gao X., McCluskey J.;
RT   "HLA-A*3004: a new A30 allele identified in an Australian Caucasoid
RT   population";
RL   Tissue Antigens 46(5):394-397(1995).
XX
RN   [2]
RP   1-646
RA   Gao X.;
RT   ;
RL   Submitted (21-DEC-1994) to the INSDC.
RL   Xiaojiang Gao, The Australian National University, Clinical Sciences,
RL   Canberra, ACT, 2601, Australia
XX
DR   MD5; f930dda38f35eda92b3259bfd58b15b1.
XX
CC   On or before Jul 6, 2011 this sequence version replaced gi:624268,
CC   gi:624269, gi:2072124.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="AD7563"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..646
FT                   /gene="HLA-A30"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A30"
FT                   /product="MHC class I antigen HLA-A30"
FT                   /db_xref="GOA:P16188"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16188"
FT                   /protein_id="AAB53658.1"
FT                   /translation="SHSMRYFSTSVSRPGSGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQERPEYWDQETRNVKAHSQTDRENLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAAHVAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A30"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A30"
FT                   /number=3
XX
SQ   Sequence 646 BP; 115 A; 160 C; 192 G; 79 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggcagt ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagaggcct gagtattggg       180
     accaggagac acggaatgtg aaggcccact cacagactga ccgagagaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtatga acagcacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc atgtggcgga gcagtggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//