Dbfetch

ID   U18789; SV 1; linear; mRNA; STD; HUM; 541 BP.
XX
AC   U18789;
XX
DT   04-MAY-1995 (Rel. 43, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class I HLA-B mRNA (HLA-B-67LAV allele) exons 2 and 3, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-541
RA   Petersdorf E.;
RT   "Molecular Diversity of HLA-B";
RL   Unpublished.
XX
RN   [2]
RP   1-541
RA   Petersdorf E.;
RT   ;
RL   Submitted (16-DEC-1994) to the INSDC.
RL   Effie Petersdorf, Human Immunogenetics, Fred Hutchinson Cancer Research
RL   Center, 1124 Columbia, Seattle, WA 98104, USA
XX
DR   MD5; 749362c98dc7069bd9bde8b8369c3794.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..541
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>541
FT                   /codon_start=3
FT                   /note="HLA-B-67LAV allele; This submission reports an
FT                   HLA-B-6701 variant (HLA-B-67LAV) that differs from the
FT                   published B-6701 sequence, GenBank Accession Number L17005"
FT                   /db_xref="GOA:Q29836"
FT                   /db_xref="H-InvDB:HIT000218467.9"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*67:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29836"
FT                   /protein_id="AAB60360.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRTYLEGTC
FT                   VEWLRRYLENGKETLQR"
FT   primer_bind     1..20
FT   exon            1..269
FT                   /number=2
FT   variation       173
FT                   /phenotype="HLA-B-67"
FT                   /replace="a"
FT   exon            270..>541
FT                   /number=3
XX
SQ   Sequence 541 BP; 111 A; 169 C; 190 G; 71 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagttcgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga acctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     g                                                                       541
//