spacer

EBI Dbfetch

ID   U18661; SV 1; linear; mRNA; STD; HUM; 403 BP.
XX
AC   U18661;
XX
DT   04-MAY-1995 (Rel. 43, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class I HLA-B mRNA (HLA-B-07ZEL allele) exons 2 and 3, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-403
RA   Petersdorf E.;
RT   "Molecular Diversity of HLA-B";
RL   Unpublished.
XX
RN   [2]
RP   1-403
RA   Petersdorf E.;
RT   ;
RL   Submitted (14-DEC-1994) to the INSDC.
RL   Effie Petersdorf, Human Immunogenetics, Fred Hutchinson Cancer Research
RL   Center, 1124 Columbia, Seattle, WA 98104, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..403
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..403
FT                   /gene="HLA-B"
FT   exon            <1..127
FT                   /gene="HLA-B"
FT                   /number=2
FT   CDS             <1..>403
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /note="HLA-B-07ZEL allele"
FT                   /db_xref="GOA:Q29677"
FT                   /db_xref="IMGT/HLA:B*07:05:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29677"
FT                   /protein_id="AAB60359.1"
FT                   /translation="APWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSH
FT                   TLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARE
FT                   AEQRRAYLEGECVEWLRRYLENGKDKLERA"
FT   variation       69
FT                   /phenotype="HLA-B-07"
FT                   /gene="HLA-B"
FT                   /replace="g"
FT                   /note="This submission reports an HLA-B-0702 variant
FT                   (HLA-B-07ZEL) that differs from the published B-0702
FT                   sequence, GenBank Accession Number M32317"
FT   exon            128..>403
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 403 BP; 89 A; 122 C; 147 G; 45 T; 0 other;
     gcgccgtgga tagagcagga ggggccggag tattgggacc ggaacacaca gatctacaag        60
     gcccaggcac agactgaccg agagagcctg cggaacctgc gcggctacta caaccagagc       120
     gaggccgggt ctcacaccct ccagagcatg tacggctgcg acgtggggcc ggacgggcgc       180
     ctcctccgcg ggcataacca gtacgcctac gacggcaagg attacatcgc cctgaacgag       240
     gacctgcgct cctggaccgc cgcggacacg gcggctcaga tcacccagcg caagtgggag       300
     gcggcccgtg aggcggagca gcggagagcc tacctggagg gcgagtgcgt ggagtggctc       360
     cgcagatacc tggagaacgg gaaggacaag ctggagcgcg ctg                         403
//


spacer
spacer