Dbfetch

ID   U18660; SV 1; linear; mRNA; STD; HUM; 540 BP.
XX
AC   U18660;
XX
DT   04-MAY-1995 (Rel. 43, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class I HLA-B mRNA (HLA-B-15AOH allele) exons 2 and 3, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-540
RA   Petersdorf E.;
RT   "Molecular Diversity of HLA-B";
RL   Unpublished.
XX
RN   [2]
RP   1-540
RA   Petersdorf E.;
RT   ;
RL   Submitted (14-DEC-1994) to the INSDC.
RL   Effie Petersdorf, Human Immunogenetics, Fred Hutchinson Cancer Research
RL   Center, 1124 Columbia, Seattle, WA 98104, USA
XX
DR   MD5; 9e1a548c3f0faf565c30f59b581bb4c3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..540
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..540
FT                   /gene="HLA-B"
FT   CDS             <1..>540
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /note="HLA-B-15AOH allele"
FT                   /db_xref="IMGT/HLA:B*15:25:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q29676"
FT                   /protein_id="AAB60358.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQ"
FT   primer_bind     1..20
FT                   /gene="HLA-B"
FT   exon            1..269
FT                   /gene="HLA-B"
FT                   /number=2
FT   variation       186
FT                   /phenotype="HLA-B-15"
FT                   /gene="HLA-B"
FT                   /replace="a"
FT                   /note="This submission reports an HLA-B-1502 variant
FT                   (HLA-B-15AOH) that differs from the published B-1502
FT                   sequence, GenBank Accession Number M75138"
FT   variation       188
FT                   /gene="HLA-B"
FT                   /replace="c"
FT   exon            270..>540
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 540 BP; 111 A; 168 C; 188 G; 73 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacat catccagagg atgtatggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggtatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
//