Dbfetch

ID   U17571; SV 1; linear; mRNA; STD; HUM; 968 BP.
XX
AC   U17571;
XX
DT   11-DEC-1994 (Rel. 42, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human isolate GU5175 MHC class I HLA-A-6601 mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Hurley C., Bei M.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-968
RA   Hurley C.;
RT   ;
RL   Submitted (23-NOV-1994) to the INSDC.
RL   Carolyn Hurley, Microbiology, Georgetown University School of Medicine,
RL   3900 Reservoir Road N.W., Washington, DC 20007, USA
XX
DR   MD5; 5ea76f37e6c941e2e589eb6170f86566.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..968
FT                   /organism="Homo sapiens"
FT                   /isolate="GU5175"
FT                   /mol_type="mRNA"
FT                   /haplotype="HLA-A23,66; B41,70; CW-"
FT                   /cell_type="B lymphoblast"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>968
FT                   /codon_start=1
FT                   /gene="HLA-A-6601"
FT                   /function="peptide presentation; histocompatibity molecule"
FT                   /db_xref="GOA:P30457"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*66:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30457"
FT                   /citation=[1]
FT                   /protein_id="AAA56781.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWETAHEAEQWRAYLEGRCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVIA"
XX
SQ   Sequence 968 BP; 183 A; 303 C; 330 G; 152 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacggaat gtgaaggccc agtcacagac tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg acggttctca caccatccag       360
     aggatgtatg gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccagcaggac       420
     gcttacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggagacgg cccatgaggc ggagcagtgg       540
     agagcctacc tggagggccg gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cgcccccaag acgcatatga ctcaccacgc tgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggga ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct       960
     gtgatcgc                                                                968
//