spacer

EBI Dbfetch

ID   U17380; SV 1; linear; mRNA; STD; HUM; 350 BP.
XX
AC   U17380;
XX
DT   03-JUN-1995 (Rel. 44, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class I HLA-DRB1 gene (HLA-DR1101V allele) mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-350
RX   DOI; 10.1111/j.1399-0039.1995.tb02458.x.
RX   PUBMED; 7652736.
RA   Robbins F., Tang T., Yao H., Ng J., Hartzman R.J., Hurley C.K.;
RT   "Direct sequencing of SSP-PCR-amplified cDNA to identify new alleles in the
RT   DR52-associated DRB1 group: identification of DRB1*1115, DRB1*1117 and
RT   DRB1*1319";
RL   Tissue Antigens 45(5):302-308(1995).
XX
RN   [2]
RP   1-350
RA   Robbins F.Y.;
RT   ;
RL   Submitted (21-NOV-1994) to the INSDC.
RL   Fu-Meei Y. Robbins, Pediatrics Dept./Bone Marrow Program, Georgetown
RL   University, 3800 Reservoir Road, Washington, DC 20007, USA
XX
DR   MD5; 8203b37140871a6f7e389ce63d89c9ed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..350
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="GN037,GN041"
FT                   /cell_type="lymphoblast"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>350
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /function="antigen presentation"
FT                   /note="HLA-DR1101V allele"
FT                   /db_xref="GOA:Q29672"
FT                   /db_xref="IMGT/HLA:DRB1*11:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29672"
FT                   /protein_id="AAC50166.1"
FT                   /translation="LALAGDTRPRFLEYSTSECHFFNGTERVRFLDRYFYNQEEDLRFD
FT                   SDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVHPKVT
FT                   VYPSKTQPLQHH"
XX
SQ   Sequence 350 BP; 77 A; 89 C; 115 G; 69 T; 0 other;
     ctggctttgg ctggggacac cagaccacgt ttcttggagt actctacgtc tgagtgtcat        60
     ttcttcaatg ggacggagcg ggtgcggttc ctggacagat acttctataa ccaagaggag       120
     gacttgcgct tcgacagcga cgtgggggag ttccgggcgg tgacggagct ggggcggcct       180
     gatgaggagt actggaacag ccagaaggac ttcctggaag acaggcgggc cgcggtggac       240
     acctactgca gacacaacta cggggttggt gagagcttca cagtgcagcg gcgagtccat       300
     cctaaggtga ctgtgtatcc ttcaaagacc cagcccctgc agcaccacaa                  350
//


spacer
spacer