spacer

EBI Dbfetch

ID   U16309; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   U16309;
XX
DT   06-JAN-1995 (Rel. 42, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class I HLA-B mRNA (HLA-B-15ZEL allele) exons 2 and 3, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Petersdorf E.;
RT   "Molecular Diversity of HLA-B";
RL   Unpublished.
XX
RN   [2]
RP   1-546
RA   Petersdorf E.;
RT   ;
RL   Submitted (25-OCT-1994) to the INSDC.
RL   Effie Petersdorf, Human Immunogenetics, Fred Hutchinson Cancer Research
RL   Center, 1124 Columbia, Seattle, WA 98104, USA
XX
CC   On Mar 9, 1995 this sequence version replaced gi:608512.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /note="similar to GenBank Accession Number U03859"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="HLA-B-15ZEL allele; This submission reports an
FT                   HLA-B-1501 variant (HLA-B-15ZEL) which is similar to
FT                   GenBank Accession Number U03859"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /note="HLA-B-15ZEL allele"
FT                   /db_xref="GOA:Q29667"
FT                   /db_xref="IMGT/HLA:B*15:24:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29667"
FT                   /protein_id="AAB60350.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   primer_bind     1..20
FT                   /gene="HLA-B"
FT   variation       229
FT                   /gene="HLA-B"
FT                   /replace="g"
FT   variation       238
FT                   /gene="HLA-B"
FT                   /replace="a"
FT   variation       240
FT                   /gene="HLA-B"
FT                   /replace="c"
FT   variation       241
FT                   /gene="HLA-B"
FT                   /replace="t"
FT   variation       244
FT                   /gene="HLA-B"
FT                   /replace="g"
FT   variation       246
FT                   /gene="HLA-B"
FT                   /replace="g"
FT   exon            271..546
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="HLA-B-15ZEL allele"
XX
SQ   Sequence 546 BP; 110 A; 174 C; 191 G; 71 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagtggaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer