spacer

EBI Dbfetch

ID   U15640; SV 1; linear; genomic DNA; STD; HUM; 413 BP.
XX
AC   U15640;
XX
DT   11-AUG-1995 (Rel. 44, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Human MHC class I antigen HLA-B (allele HLAB39uw3) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-413
RX   DOI; 10.1007/BF00164983.
RX   PUBMED; 7797264.
RA   Garber T.L., Butler L.M., Trachtenberg E.A., Erlich H.A., Rickards O.,
RA   De Stefano G., Watkins D.I.;
RT   "HLA-B alleles of the Cayapa of Ecuador: new B39 and B15 alleles";
RL   Immunogenetics 42(1):19-27(1995).
XX
RN   [2]
RP   1-413
RA   Garber T.L.;
RT   ;
RL   Submitted (07-OCT-1994) to the INSDC.
RL   Theodore L. Garber, Wisconsin Regional Primate Research Center, University
RL   of Wisconsin, 1220 Capitol Ct., Madison, WI 53715
XX
DR   MD5; 2549f6061a91f9943de4f1e5623298b9.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..413
FT                   /organism="Homo sapiens"
FT                   /isolate="American Indian, Cayapa tribe, Ecuador,
FT                   individuals 11 and 1276"
FT                   /mol_type="genomic DNA"
FT                   /clone="123-8 and 353-1"
FT                   /db_xref="taxon:9606"
FT   gene            1..413
FT                   /gene="HLA-B"
FT   CDS             <1..>413
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="allele HLAB39uw3"
FT                   /db_xref="GOA:P30475"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*39:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30475"
FT                   /protein_id="AAA74047.1"
FT                   /translation="FDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYL"
XX
SQ   Sequence 413 BP; 90 A; 128 C; 146 G; 49 T; 0 other;
     ggttcgacag cgacgccgcg agtccgagag aggagccgcg ggcgccgtgg atagagcagg        60
     aggggccgga atattgggac cggaacacac agatctgcaa gaccaacaca cagacttacc       120
     gagagagcct gcggaacctg cgcggctact acaaccagag cgaggccggg tctcacaccc       180
     tccagaggat gtacggctgc gacgtggggc cggacgggcg cctcctccgc gggcatgacc       240
     agtccgccta cgacggcaag gattacatcg ccctgaacga ggacctgagc tcctggaccg       300
     cggcggacac cgcggctcag atcacccagc gcaagtggga ggcggcccgt gtggcggagc       360
     agctgagaac ctacctggag ggcacgtgcg tggagtggct ccgcagatac ctg              413
//


spacer
spacer